Recombinant Rat Alpha-2B adrenergic receptor (Adra2b)

Shipped with Ice Packs
In Stock

Description

Definition and Production

The Recombinant Rat Alpha-2B Adrenergic Receptor (UniProt ID: P19328) is a full-length (1–453 amino acids) protein fused to an N-terminal His tag for purification and detection. It is produced in E. coli expression systems and purified to >90% purity via SDS-PAGE .

PropertyDetails
Source OrganismRat (Rattus norvegicus)
Expression SystemEscherichia coli (E. coli)
TagHis tag
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDissolve in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for storage

Hypertension Studies

  • Mechanism: Adra2b mediates salt-induced hypertension via central nervous system regulation .

    • Example: Intracerebroventricular delivery of antisense DNA targeting Adra2b in rats reduced blood pressure by 35 ± 12 mm Hg for >16 days .

Ligand Binding Profiling

  • Pharmacological Profile:

    LigandRank Order (Potency)Binding Affinity (Kd)
    AgonistsClonidine > Norepinephrine
    AntagonistsYohimbine > Chlorpromazine2 nM ([3H]rauwolscine)

Key Research Findings

  • Hypertension Reversal: Adra2b inhibition via antisense DNA in salt-loaded rats reduced blood pressure by 45–65% through central nervous system modulation .

  • Obesity Link: Polymorphic Adra2b variants with impaired desensitization correlate with reduced metabolic rates in obese subjects .

  • Comparative Biology: Rat Adra2b shares 78% sequence identity with human ADRA2B, enabling cross-species translational studies .

Signaling Pathways

Adra2b couples to Gi/o proteins, inhibiting adenylate cyclase and reducing cAMP levels . It also interacts with:

  • eIF-2B: Modulates translational regulation .

  • RAB26 and GGA1/2/3: Mediates Golgi-to-cell membrane trafficking .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
Adra2b; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSGPTMDHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLA AADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVS RALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQCELNQEAWYILA SSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPQPVAGGVPTSAKVP TLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPTWSALPRSGQGQKKGTSGATAE EGDEEDEEEVEECEPQTLPASPASVCNPPLQQPQTSRVLATLRGQVLLGKNVGVASGQWW RRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYC NSSLNPVIYTVFNQDFRRAFRRILCRPWTQTGW
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References Into Functions
  1. Report specific roles of alpha2A - and alpha2B -, but not alpha2C -, adrenoceptor subtypes in the inhibition of the vasopressor sympathetic out-flow in diabetic pithed rats. PMID: 25407049
  2. In aging, the alpha-2B receptor mediated feedback inhibition of epinephrine release from the adrenal medulla is preserved in control rats but compromised in hypertensive rats, resulting in increased epinephrine release. PMID: 20691504
  3. Alpha2B-adrenergic receptor interaction with tubulin controls its transport from the endoplasmic reticulum to the cell surface PMID: 21357695
  4. alpha 2B-adrenergic receptor activates MAPK via a pathway involving arachidonic acid metabolism, matrix metalloproteinases, and epidermal growth factor receptor transactivation. PMID: 11891218
  5. alpha2-adrenoceptors are inhibitory after nerve injury, not excitatory PMID: 15680702
  6. These data demonstrate that Rab2 and Rab6 differentially influence anterograde transport and signaling of GPCRs. PMID: 17716866

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of rat Alpha-2B adrenergic receptor?

The rat Alpha-2B adrenergic receptor is a G protein-coupled receptor characterized by seven transmembrane domains, which is typical of the biogenic amine receptor family. The receptor has been cloned (pRNG alpha 2) from rat kidney cDNA libraries. Structurally, it contains the conserved features of guanyl nucleotide-binding protein-coupled receptors, though notably it lacks a consensus N-linked glycosylation site near the amino terminus, distinguishing it from some other members of this receptor family . The receptor contains a highly conserved cysteine residue (Cys-169) that has been demonstrated to be essential for ligand binding, as mutation of this residue to phenylalanine abolishes binding activity .

How does the rat Alpha-2B adrenergic receptor differ from other adrenergic receptor subtypes?

The rat Alpha-2B adrenergic receptor is part of the heterogeneous alpha-2 adrenergic receptor family but exhibits distinct pharmacological properties. When expressed in transfected cells, the receptor shows a specific binding profile with the following rank order of potency: yohimbine ≥ chlorpromazine ≥ prazosin ≥ clonidine ≥ norepinephrine ≥ oxymetazoline . Unlike the alpha-2A subtype, the alpha-2B receptor undergoes short-term agonist-promoted desensitization, which occurs through phosphorylation by G-protein coupled receptor kinases (GRKs), ultimately resulting in uncoupling of the receptor from its associated G-protein subunit . This distinctive desensitization mechanism has significant implications for the receptor's physiological function and pharmacological targeting.

What are the primary tissue expression patterns of rat Alpha-2B adrenergic receptor?

The rat Alpha-2B adrenergic receptor exhibits a tissue-specific expression pattern. RNA analysis has revealed that the predominant mRNA species (approximately 4000 nucleotides) accumulates primarily in rat kidney and neonatal rat lung . Western blot analysis using specific antibodies against the alpha-2B adrenergic receptor has confirmed protein expression in rat kidney, lung, and liver tissues, with particularly strong expression observed in the respiratory epithelium of the bronchioli in rat lung tissue . This expression pattern suggests tissue-specific roles in renal and pulmonary function, which may be particularly relevant during development or in pathophysiological conditions.

What expression systems are most effective for recombinant rat Alpha-2B adrenergic receptor production?

For successful recombinant production of functional rat Alpha-2B adrenergic receptor, mammalian expression systems are generally preferred over bacterial systems due to the need for proper post-translational modifications and membrane insertion. COS cells have been effectively used for transient expression of the receptor, with transfected cells demonstrating high-affinity and saturable binding to radioligands such as [3H]rauwolscine (Kd = 2 nM) . For stable expression, HEK293 or CHO cell lines are commonly employed. When designing expression constructs, it is critical to maintain the integrity of the conserved cysteine residue at position 169, as mutation of this residue has been shown to abolish ligand binding capability . Codon optimization for mammalian expression and inclusion of purification tags should be considered for downstream applications, though tags should be placed strategically to avoid interference with receptor function.

How can expression levels of recombinant rat Alpha-2B adrenergic receptor be optimized?

Optimizing expression levels of recombinant rat Alpha-2B adrenergic receptor requires a multifaceted approach:

  • Vector selection: Use mammalian expression vectors with strong promoters (CMV or EF1α)

  • Cell line selection: Test multiple cell lines (HEK293, CHO, COS-7) for highest expression

  • Transfection optimization: Evaluate different transfection reagents and DNA:reagent ratios

  • Culture conditions: Adjust temperature (30-37°C), serum concentration, and addition of receptor-stabilizing ligands during expression

  • Addition of molecular chaperones: Co-expression with molecular chaperones can increase proper folding and surface expression

When evaluating expression, it is important to assess not just total protein levels but functional receptor density using radioligand binding assays with [3H]rauwolscine or similar ligands . Alpha-2B receptor tends to undergo agonist-induced desensitization , so culture conditions should be optimized to minimize constitutive activation during expression.

What are the critical quality control parameters for verifying recombinant rat Alpha-2B adrenergic receptor integrity?

Verification of recombinant rat Alpha-2B adrenergic receptor integrity should include multiple complementary approaches:

  • Binding affinity assessment: Radioligand binding assays using [3H]rauwolscine should demonstrate a Kd value of approximately 2 nM, consistent with the native receptor

  • Pharmacological profile verification: Competition binding assays should confirm the characteristic rank order of potency (yohimbine ≥ chlorpromazine ≥ prazosin ≥ clonidine ≥ norepinephrine ≥ oxymetazoline)

  • Receptor functionality: Functional coupling to G proteins can be assessed through GTPγS binding assays or cAMP inhibition assays

  • Protein integrity: Western blot analysis using specific antibodies such as Anti-α2B-Adrenergic Receptor (extracellular) Antibody should show the expected molecular weight and no degradation products

  • Surface expression: Flow cytometry analysis of intact cells can confirm proper cell surface localization

Particular attention should be paid to the conserved cysteine residue at position 169, as modification of this residue has been shown to abolish ligand binding capability .

What are the most reliable methods for detecting and quantifying rat Alpha-2B adrenergic receptor expression?

Multiple complementary approaches can be employed for detecting and quantifying rat Alpha-2B adrenergic receptor expression:

For mRNA quantification:

  • RT-qPCR targeting the specific mRNA sequence (predominant species is 4000 nucleotides)

  • Northern blot analysis for tissue expression profiling

For protein detection and quantification:

  • Western blot analysis using specific antibodies such as Anti-α2B-Adrenergic Receptor (extracellular) Antibody at 1:200 dilution

  • Immunohistochemistry of tissue sections (1:100 dilution for paraffin-embedded sections)

  • Flow cytometry for cell surface expression (typically using 5μg antibody per assay)

  • Radioligand binding assays using [3H]rauwolscine (Kd = 2 nM) for functional receptor quantification

When selecting detection methods, consider that expression patterns may vary significantly between tissues, with notable expression in kidney, lung, and to a lesser extent in liver and skeletal muscle . For recombinant systems, the combination of binding assays and surface expression analysis provides the most comprehensive assessment of functionally relevant receptor levels.

What are the recommended protocols for studying ligand binding properties of rat Alpha-2B adrenergic receptor?

For rigorous characterization of ligand binding properties of rat Alpha-2B adrenergic receptor:

Saturation Binding Protocol:

  • Prepare membrane fractions from cells expressing the receptor

  • Incubate membranes (50-100 μg protein) with increasing concentrations of [3H]rauwolscine (0.1-10 nM)

  • Determine non-specific binding using 10 μM unlabeled yohimbine

  • Incubate at room temperature for 60 minutes

  • Terminate binding by rapid filtration

  • Analyze data using non-linear regression to determine Kd (expected ~2 nM) and Bmax

Competition Binding Protocol:

  • Incubate membranes with a fixed concentration of [3H]rauwolscine (~2 nM)

  • Add increasing concentrations of test compounds

  • Expected rank order of potency: yohimbine ≥ chlorpromazine ≥ prazosin ≥ clonidine ≥ norepinephrine ≥ oxymetazoline

  • Analyze data using appropriate competition binding models to determine Ki values

When performing these assays, it is critical to consider that the conserved cysteine residue (Cys-169) is essential for ligand binding, as mutation to phenylalanine abolishes binding activity . Temperature, pH, and buffer composition should be carefully controlled and reported for reproducibility.

How can functional signaling of recombinant rat Alpha-2B adrenergic receptor be assessed?

Assessment of functional signaling mediated by recombinant rat Alpha-2B adrenergic receptor should address multiple pathways:

G-protein coupling assays:

  • [35S]GTPγS binding assay to measure G-protein activation

  • cAMP inhibition assay (Alpha-2B receptors inhibit adenylyl cyclase via Gi/o proteins)

  • Calcium mobilization assays using fluorescent indicators

Receptor desensitization and trafficking:

  • Phosphorylation assays using phospho-specific antibodies

  • Internalization assays using fluorescently tagged receptors

  • β-arrestin recruitment assays using BRET or FRET technologies

Downstream signaling pathways:

  • ERK1/2 phosphorylation

  • Regulation of ion channels (particularly K+ channels)

Unlike the alpha-2A subtype, the alpha-2B receptor undergoes short-term agonist-promoted desensitization through phosphorylation by G-protein coupled receptor kinases (GRKs) . This desensitization mechanism should be considered when designing functional assays, as the kinetics of response may differ from other adrenergic receptor subtypes. Additionally, the interaction with various proteins like SRC, USP20, and USP33 may influence signaling outcomes and should be considered in experimental design.

What role does rat Alpha-2B adrenergic receptor play in renal function and hypertension?

The rat Alpha-2B adrenergic receptor has significant implications for renal function and blood pressure regulation. Research has demonstrated that testosterone regulates renal α2B-adrenergic receptor gene expression at the mRNA level in spontaneously hypertensive rats (SHR) . This hormonal regulation suggests a potential mechanism linking androgens, adrenergic receptor expression, and hypertension. The receptor is abundantly expressed in rat kidney tissue , where it likely influences renal vascular resistance, sodium handling, and renin release.

From a pathophysiological perspective, alterations in Alpha-2B adrenergic receptor expression or function may contribute to hypertensive phenotypes through:

  • Enhanced vasoconstriction in the renal vasculature

  • Altered sodium reabsorption in the proximal tubule

  • Modulation of sympathetic outflow to the kidney

  • Interaction with the renin-angiotensin-aldosterone system

Researchers investigating the role of this receptor in hypertension should consider sex differences in receptor expression and function, given the established role of testosterone in regulating receptor expression . Pharmacological interventions targeting this receptor may offer therapeutic potential for hypertension, particularly in cases with elevated sympathetic activity.

How does Alpha-2B adrenergic receptor expression change during development and in disease states?

Alpha-2B adrenergic receptor expression exhibits dynamic regulation during development and in various pathophysiological conditions. In rats, the receptor shows notably high expression in neonatal lung tissue , suggesting a potential developmental role in pulmonary function. This expression pattern changes throughout maturation, which may reflect shifting physiological requirements.

In disease states, several patterns have been observed:

Hypertension:

  • Altered expression in spontaneously hypertensive rats

  • Testosterone-dependent regulation may contribute to sex differences in hypertension prevalence

Respiratory disorders:

  • Given the expression in respiratory epithelium of the bronchioli , changes in receptor density or function may influence airway reactivity

  • Potential implications for asthma or chronic obstructive pulmonary disease

Metabolic disorders:

  • Related beta-adrenergic receptors are implicated in obesity and type 2 diabetes

  • Alpha-2B receptors may similarly influence metabolic regulation

Understanding these dynamic expression patterns requires careful consideration of tissue-specific regulation, hormonal influences, and disease progression. Experimental designs should account for potential confounding factors such as age, sex, and comorbidities when investigating receptor expression in disease models.

What are the challenges and solutions for creating stable cell lines expressing rat Alpha-2B adrenergic receptor?

Creating stable cell lines expressing functional rat Alpha-2B adrenergic receptor presents several challenges with corresponding solutions:

Challenges:

  • Receptor downregulation: Constitutive activity can lead to receptor internalization and downregulation

  • Toxicity: Overexpression may disrupt cellular signaling homeostasis

  • Selection pressure: Maintaining stable expression over multiple passages

  • Functional integrity: Ensuring receptors maintain native binding and signaling properties

Solutions:

  • Inducible expression systems: Use tetracycline-inducible promoters to control expression levels

  • Strategic antibiotic selection: Titrate antibiotic concentration to maintain optimal expression

  • Single cell cloning and characterization: Isolate clones with desired expression levels and functional properties

  • Cell line engineering: Consider CRISPR/Cas9 for targeted integration at safe harbor loci

  • Growth conditions optimization: Culture at lower temperatures (30-32°C) to improve folding

  • Addition of receptor ligands: Include antagonists during culture to stabilize receptor conformation

For verification of stable expression, implement regular quality control using binding assays with [3H]rauwolscine to confirm the expected Kd of approximately 2 nM . Monitor the pharmacological profile periodically through competition binding assays to verify maintenance of the characteristic rank order of potency. Flow cytometry analysis can also confirm consistent cell surface expression levels across passages .

How can site-directed mutagenesis be used to investigate structure-function relationships in rat Alpha-2B adrenergic receptor?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in rat Alpha-2B adrenergic receptor:

Key residues for targeted mutagenesis:

  • Cysteine-169: This conserved residue is critical for ligand binding, as demonstrated by the loss of [3H]rauwolscine binding when mutated to phenylalanine

  • Transmembrane domain residues involved in ligand binding pocket formation

  • Intracellular loop residues implicated in G-protein coupling

  • Phosphorylation sites involved in receptor desensitization

  • C-terminal residues mediating β-arrestin recruitment

Methodological approach:

  • Generate single point mutations using PCR-based methods

  • Create chimeric receptors between alpha-2B and other subtypes to identify subtype-specific domains

  • Express mutant receptors in COS cells or similar expression systems

  • Characterize using binding assays, G-protein activation assays, and internalization studies

Analysis should include comprehensive characterization of mutant receptors:

  • Binding parameters (Kd, Bmax) using [3H]rauwolscine

  • Agonist potency and efficacy in functional assays

  • Patterns of desensitization and internalization

  • G-protein coupling specificity

This approach has already yielded valuable insights into the role of conserved residues, such as the demonstration that Cys-169 is essential for ligand binding . Further mutagenesis studies could explore the structural basis for the unique pharmacological profile and desensitization properties of the alpha-2B subtype compared to other adrenergic receptors.

What advanced imaging techniques can be applied to study rat Alpha-2B adrenergic receptor trafficking and localization?

Advanced imaging techniques offer powerful approaches to investigate the dynamic trafficking and subcellular localization of rat Alpha-2B adrenergic receptor:

Confocal microscopy approaches:

  • Fluorescent protein tagging (GFP, mCherry) of the receptor for live cell imaging

  • Immunofluorescence with Anti-α2B-Adrenergic Receptor antibodies (1:300 dilution) for fixed cell imaging

  • Pulse-chase labeling with receptor-specific antibodies to track internalization kinetics

  • Co-localization studies with markers for early endosomes, recycling endosomes, and lysosomes

Super-resolution techniques:

  • STORM or PALM imaging to resolve receptor nanoclusters at the plasma membrane

  • STED microscopy for high-resolution imaging of receptor trafficking

  • Single-particle tracking to monitor individual receptor molecules

Advanced functional imaging:

  • FRET/BRET biosensors to monitor receptor-effector interactions

  • Fluorescence recovery after photobleaching (FRAP) to assess receptor lateral mobility

  • Bimolecular fluorescence complementation to visualize protein-protein interactions

When applying these techniques, researchers should consider that alpha-2B adrenergic receptors undergo agonist-induced desensitization and may exhibit distinct trafficking patterns compared to other adrenergic receptor subtypes. Visualization of receptor dynamics in polarized cells (such as renal epithelial cells) may be particularly informative given the receptor's physiological relevance in kidney function .

What are the implications of alpha-2B adrenergic receptor polymorphisms for translational research?

While rat models provide valuable insights into alpha-2B adrenergic receptor biology, understanding receptor polymorphisms has significant translational implications:

Genetic variation considerations:

  • Species-specific polymorphisms may affect drug responses differently between rats and humans

  • Functional consequences of polymorphisms may include altered:

    • Ligand binding affinity

    • G-protein coupling efficiency

    • Desensitization kinetics

    • Receptor expression levels

Translational research approaches:

  • Comparative genomics between rat and human alpha-2B receptors

  • Expression of rat vs. human receptor variants in identical cellular backgrounds

  • Development of "humanized" rat models expressing human receptor variants

  • Pharmacogenomic studies correlating receptor variants with drug responses

When designing translational studies, researchers should consider that the rat alpha-2B receptor shows important similarities to the human ortholog in terms of G-protein coupling and ligand binding preferences, but species differences in regulatory elements may influence expression patterns. The testosterone-dependent regulation observed in rats may have implications for sex-specific drug responses in humans, warranting investigation of hormonal influences across species.

How do interactions between alpha-2B adrenergic receptor and other membrane proteins influence its function?

The functional properties of alpha-2B adrenergic receptor are significantly modulated by interactions with various membrane proteins and intracellular partners:

Key interaction partners:

  • G-proteins (primarily Gi/o family)

  • G-protein coupled receptor kinases (GRKs) - involved in phosphorylation and desensitization

  • Arrestins - mediating receptor internalization

  • SRC, USP20 and USP33 - interacting proteins identified in related adrenergic receptors

  • Ion channels - potential downstream effectors

Methodological approaches to study interactions:

  • Co-immunoprecipitation with Anti-α2B-Adrenergic Receptor antibodies

  • Proximity ligation assays for in situ detection of protein-protein interactions

  • FRET/BRET assays to measure dynamic interactions

  • Proteomic analysis of receptor complexes using mass spectrometry

Understanding these interactions is crucial for comprehending the receptor's physiological roles. For example, the alpha-2B receptor undergoes short-term agonist-promoted desensitization through GRK-mediated phosphorylation , a process that likely involves arrestin recruitment and subsequent alterations in signaling pathways. Disruptions in these interaction networks may contribute to pathophysiological conditions and represent potential targets for therapeutic intervention.

What are the latest developments in alpha-2B adrenergic receptor-targeted therapeutics?

Recent advancements in understanding alpha-2B adrenergic receptor biology have spurred development of novel therapeutic approaches:

Emerging therapeutic strategies:

  • Subtype-selective ligands with improved alpha-2B specificity

  • Biased ligands that selectively activate beneficial signaling pathways

  • Allosteric modulators that fine-tune receptor function

  • Gene therapy approaches to modulate receptor expression in specific tissues

Potential therapeutic applications:

  • Hypertension - given the receptor's role in renal function and testosterone-dependent regulation

  • Respiratory disorders - based on expression in bronchiolar epithelium

  • Pain management - through modulation of sympathetic signaling

  • Metabolic disorders - similar to applications targeting related adrenergic receptors

When evaluating alpha-2B-targeted therapeutics, researchers should consider the receptor's unique pharmacological profile, with its characteristic rank order of potency: yohimbine ≥ chlorpromazine ≥ prazosin ≥ clonidine ≥ norepinephrine ≥ oxymetazoline . The potential for cross-reactivity with other adrenergic receptor subtypes necessitates careful pharmacological characterization. Additionally, the testosterone-dependent regulation observed in rats suggests potential sex differences in therapeutic responses that should be systematically evaluated in preclinical and clinical studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.