Recombinant Rat Alpha-2C adrenergic receptor (Adra2c)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The Adra2c gene (rat: Adra2c) encodes a 458-amino acid protein located on chromosome 14q21 . Key features include:

AttributeDetails
Gene IDENSRNOG00000009299 (Rat)
Protein Length458 amino acids
Chromosomal LocationRat: 14q21
IntronsNone in coding/untranslated regions (intronless gene structure)

The protein belongs to the alpha-2 adrenergic receptor family, which includes subtypes alpha-2A, alpha-2B, and alpha-2C. These receptors inhibit neurotransmitter release presynaptically and regulate postsynaptic signaling via G protein-coupled pathways .

Production and Purity

Recombinant Adra2c is produced in diverse systems to enable functional and structural studies:

Host SystemAdvantagesLimitationsPurityApplications
E. coliHigh yield, cost-effectiveLimited post-translational modifications≥85% (SDS-PAGE) Structural studies
Mammalian CellsNative folding, glycosylationLower yield, higher cost≥85% Functional assays
Baculovirus/Insect CellsProper membrane integrationSpecialized equipment required≥85% Pharmacological studies

Host choice impacts receptor activity. For example, mammalian systems better mimic native G protein coupling, while bacterial systems prioritize structural analysis .

Functional Roles in Physiology

Adra2c modulates diverse physiological processes:

  • Neurotransmitter Regulation: Inhibits norepinephrine release in sympathetic nerves and central noradrenergic neurons .

  • Behavioral Modulation: Linked to sensorimotor gating, stress response, and aggression .

  • Cardiovascular Function: Regulates heart rate and blood pressure via presynaptic inhibition .

  • Metabolic Control: Influences lipolysis in adipose tissue .

Key Differences from Other Alpha-2 Subtypes:

ParameterAlpha-2CAlpha-2A
Stimulation SensitivityLow-frequency nerve activity High-frequency inhibition
Subcellular LocalizationAxonal termini Cell body/dendrites
Behavioral ImpactEnhanced startle response, aggression Anxiety/depression modulation

Research Applications

Adra2c is utilized in:

  • Drug Discovery: Screening alpha-2C-specific agonists/antagonists (e.g., MK912, yohimbine) .

  • Disease Modeling: Studying schizophrenia (sensorimotor gating deficits) and cardiovascular disorders .

  • ELISA Assays: Quantifying Adra2c levels in rat tissues/fluids (sensitivity: 0.122 ng/mL) .

Pharmacological Insights

Adra2c signaling can be engineered to couple with calcium-mobilizing G proteins (e.g., Galpha(qi5)) for functional assays .

LigandPotency (EC50)ActionSource
Noradrenaline~10 μMAgonist
Brimonidine~100 nMAgonist
Yohimbine~10 nMAntagonist
MK912~1 nMAntagonist

These ligands are critical for elucidating Adra2c’s role in GPCR signaling pathways .

Clinical and Therapeutic Relevance

  • Psychiatric Disorders: Alpha-2C antagonists (e.g., ORM-12741) show promise in treating schizophrenia and PTSD .

  • Glaucoma: Alpha-2 agonists (e.g., brimonidine) reduce intraocular pressure via alpha-2C-mediated mechanisms .

  • Obesity: Adra2c inhibition may influence lipolysis in adipose tissue .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
Adra2c; Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWGPPPGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References Into Functions
  1. Recent findings suggest that alpha2-adrenoceptors do not play a significant role in any indices of female sexual behavior. PMID: 25218984
  2. The adverse effects of prenatal malnutrition on neocortical plasticity in adult offspring are partly attributed to increased neocortical alpha(2C)-adrenoceptor expression. PMID: 22892388
  3. In rats with 6-OHDA-lesions, no change in alpha2C adrenoceptor expression was observed in the rostral or caudal striatum, regions where the highest density of alpha2C mRNA is present. PMID: 21562737
  4. During aging, the alpha-2C receptor-mediated feedback inhibition of epinephrine release from the adrenal medulla is preserved in control rats but compromised in hypertensive rats, resulting in increased epinephrine release. PMID: 20691504
  5. During the development of hypertension, adrenal alpha(2) -adrenoceptor inhibitory function is maintained, accompanied by reduced noradrenaline release and unchanged adrenaline release in spontaneously hypertensive rats. PMID: 21518261
  6. Stimulation of adrenergic alpha 2 receptors in the central nucleus of the amygdala attenuates stress-induced reinstatement of nicotine seeking behavior. PMID: 20854830
  7. Findings indicate that changes in beta(2)- and alpha(2C)-adrenergic receptors participate in IL-6-mediated processes in the spleen, especially during chronic stress situations. PMID: 20607388
  8. In a chronic spinal cord injury rat model, alpha(2)-ARs gene expression is downregulated in the injured segment, but returns to the normal level above and below the injured segment. PMID: 19000416
  9. Intraspinal modulation of the noradrenergic and adrenergic control of the autonomic outflow to the penis by pre- and postsynaptic alpha(2) adrenoceptors. PMID: 12379250
  10. Alpha 2C-adrenergic receptors are present on axon terminals of spinal interneurons, with the majority forming axo-dendritic synapses, although a small number of axo-axonic synapses are also found. PMID: 12401319
  11. Data indicate that most dorsal horn axons possessing alpha 2C-adrenergic receptors are excitatory, further supporting the suggestion that they primarily originate from spinal interneurons. PMID: 12591145
  12. Alpha 2C-AR terminals are presynaptic to dendrites and somata of lateral spinal nucleus (LSN) neurons and predominantly form asymmetric synapses. PMID: 15207357
  13. alpha(2A)- and alpha(2C)-adrenoceptors play dominant roles in the regulation of cervical resistance on days 18-21. PMID: 19450576

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2C sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the distribution pattern of Alpha-2C adrenergic receptors in rat neural tissue?

Alpha-2C adrenergic receptors (ARs) in rat brain and spinal cord have been extensively mapped using immunohistochemical techniques. Studies have demonstrated that Alpha-2C AR-like immunoreactivity (alpha 2C-AR-LI) is predominantly localized in neuronal perikarya, with some labeling extending to proximal dendrites. Confocal microscopy analysis reveals that a significant portion of this immunoreactivity is intracellularly localized, suggesting complex trafficking and signaling mechanisms of these receptors .

The distribution pattern is more restricted compared to Alpha-2A ARs, which are widely expressed throughout the central nervous system (CNS). This restricted distribution pattern implies specialized functions in specific neural circuits .

What methods are most effective for generating antibodies against recombinant rat Adra2c?

Generation of subtype-specific antibodies for Alpha-2C ARs requires careful design strategies:

  • Recombinant fusion protein approach: Effective antibodies have been generated using a fusion protein consisting of a 70-amino-acid polypeptide portion from the third intracellular loop of Alpha-2C AR fused to glutathione-S-transferase. This region was selected for its low sequence homology with other adrenergic receptor subtypes .

  • Validation protocol: Antibody selectivity and subtype specificity should be rigorously demonstrated through:

    • Immunoprecipitation of [125I]-photoaffinity-labeled Alpha-2 ARs

    • Immunohistochemical labeling of COS cells expressing individual rat Alpha-2 AR subtypes

    • Elimination of immunoreactivity through preadsorption with excess antigen

How do Alpha-2C ARs differ functionally from other adrenergic receptor subtypes?

Alpha-2C ARs exhibit several distinctive functional characteristics compared to Alpha-2A ARs:

CharacteristicAlpha-2C ARAlpha-2A AR
DistributionRestricted expressionWidely distributed throughout CNS
Activation thresholdFunctional at higher (micromolar) concentrations of noradrenalineActivated at lower noradrenaline concentrations
Deactivation kineticsSlow deactivation upon noradrenaline removalRelatively faster deactivation
Presynaptic inhibitionSlower inhibition of noradrenaline releaseFaster inhibition of noradrenaline release
Maximum inhibition of NA releaseLimited (20-30% in hippocampal tissue)More pronounced inhibition
Functional prominenceMore prominent during states of low endogenous noradrenaline activityMore engaged during states of high noradrenergic tone
Heteroreceptor functionRegulates non-noradrenergic transmission (serotonin, dopamine)Primarily functions as autoreceptor

This functional differentiation suggests that Alpha-2C ARs provide more subtle and targeted effects on noradrenaline release, potentially reducing cardiovascular side effects associated with broader Alpha-2A AR modulation .

What experimental approaches are optimal for studying epigenetic regulation of Adra2c?

Epigenetic regulation of Adra2c can be comprehensively investigated using these methodological approaches:

  • Histone post-translational modifications (PTMs) analysis:

    • Evaluate both permissive and repressive histone modifications at Adra2c promoter regions

    • Key histone marks to assess include H3K4me3, H3K27me3, H3ac, H3K9ac, H3K27ac (on histone H3) and H4K5ac and H4K16ac (on histone H4)

    • Chromatin immunoprecipitation (ChIP) followed by qPCR or sequencing can quantify these modifications at the Adra2c gene locus

  • RNA extraction and quality assessment protocol:

    • Normalize isolated DNA samples to 20 ng/μl

    • Assess RNA integrity number (RIN) using Agilent 2100 Bioanalyzer

    • Perform DNase digestion using Deoxyribonuclease I, Amplification Grade

    • Convert 1 μg of total RNA to cDNA using High-Capacity cDNA Reverse Transcription kit

  • PCR amplification for genetic variants:

    • For specific polymorphisms like the ADRA2C del (322–325), use targeted primers:
      Forward: 5'-GTGGAGCCGGACGAGAGC-3'
      Reverse: 5'-GGCGCGACAGGAAGAACTC-3'

    • Perform 45 PCR cycles under these conditions: 94°C for 4 minutes, 94°C for 30 seconds, 62°C for 30 seconds, 72°C for 30 seconds, with final extension for 10 minutes at 72°C

These approaches provide a comprehensive platform for examining how epigenetic mechanisms influence Adra2c expression in different physiological and pathological contexts.

How does Adra2c expression change in response to pharmacological interventions?

Adra2c expression demonstrates significant responsiveness to pharmacological treatments, particularly antipsychotics. Research findings indicate:

These findings highlight the dynamic nature of Adra2c expression and its potential role in the therapeutic mechanisms of antipsychotic medications.

What are the current methodologies for investigating Alpha-2C AR involvement in neuropsychiatric disorders?

Investigation of Alpha-2C AR in neuropsychiatric disorders employs multi-faceted approaches:

  • Genetic association studies:

    • Analysis of polymorphisms like ADRA2C del (322–325), which has been associated with autonomic activity and thermoregulation

    • The polymorphism has higher prevalence in specific populations (e.g., African American women) and may contribute to differential symptom presentation

  • Postmortem brain tissue analysis:

    • Examination of ADRA2C expression in regions like dorsolateral prefrontal cortex (DLPFC) from individuals with schizophrenia

    • Comparison between antipsychotic-free and antipsychotic-treated subjects to distinguish disease effects from treatment effects

  • Pharmacological probes:

    • Selective Alpha-2C AR antagonists (ORM-13070, ORM-10921, ORM-12741) allow targeted investigation of receptor function

    • ORM-13070 serves as a positron emission tomography ligand

    • ORM-10921 has demonstrated antipsychotic, antidepressant, and pro-cognitive actions in animal models

    • ORM-12741 is in clinical development for treating cognitive dysfunction and neuropsychiatric symptoms in Alzheimer's disease

  • Single-cell RNA sequencing:

    • Analysis of cell-type-specific expression patterns of Adra2c

    • Integration with functional assays to understand circuit-level effects

What techniques are available for studying Alpha-2C AR pharmacodynamics in recombinant systems?

Several sophisticated techniques allow detailed investigation of Alpha-2C AR pharmacodynamics:

  • Receptor binding kinetics:

    • Comparative studies have revealed that Alpha-2C ARs display much slower deactivation upon removal of noradrenaline than Alpha-2A ARs

    • This distinct kinetic profile can be measured using radioligand binding assays with time-course analysis

  • Functional concentration-response relationships:

    • Alpha-2C ARs are functional at higher (micromolar) concentrations of noradrenaline compared to Alpha-2A ARs

    • Concentration-response curves can be generated using cellular assays measuring second messenger signaling (cAMP, calcium, etc.)

  • Presynaptic modulation assessment:

    • Alpha-2C AR-mediated presynaptic inhibition occurs more slowly than that mediated by Alpha-2A ARs

    • The inhibitory effect of Alpha-2C ARs on noradrenaline release is more limited (maximum 20–30% in hippocampal tissue) compared to Alpha-2A ARs

    • These properties can be measured using neurotransmitter release assays in synaptosomes or brain slices

  • Transgenic approaches:

    • Development of recombinant systems with inducible or tissue-specific expression

    • Incorporation of reporter tags for visualizing trafficking and localization

What is the therapeutic potential of selectively targeting Alpha-2C adrenergic receptors?

Selective targeting of Alpha-2C ARs holds significant therapeutic promise across multiple neuropsychiatric disorders:

  • Depression and anxiety:

    • Alpha-2C AR antagonism may produce antidepressant effects through modulation of noradrenergic, serotonergic, and dopaminergic neurotransmission

    • Animal studies with selective Alpha-2C AR antagonists like ORM-10921 have demonstrated antidepressant-like effects

  • Schizophrenia:

    • ADRA2C gene expression is upregulated in schizophrenia subjects (+53%) regardless of antipsychotic treatment

    • Selective Alpha-2C AR antagonism may provide more targeted effects than non-selective Alpha-2 AR antagonism (as with clozapine), potentially improving efficacy while reducing side effects

  • Cognitive dysfunction:

    • ORM-12741, a selective Alpha-2C AR antagonist, is in clinical development for treating cognitive dysfunction in Alzheimer's disease

    • Preclinical studies indicate pro-cognitive effects of Alpha-2C AR antagonism, suggesting utility for cognitive symptoms across multiple disorders

  • Avoidance of cardiovascular side effects:

    • Alpha-2C AR antagonism produces more subtle effects on noradrenaline release compared to Alpha-2A AR antagonism

    • This may translate to improved cardiovascular safety profile compared to non-selective Alpha-2 AR antagonists

How does Alpha-2C AR function differ in pathological states compared to normal conditions?

Alpha-2C AR function undergoes significant alterations in pathological states:

  • Cancer-related changes:

    • Analysis across 33 cancer types has revealed that ADRA2C expression varies across different clinical stages in several cancers including breast invasive carcinoma (BRCA), esophageal adenocarcinoma (ESCA), kidney renal papillary cell carcinoma (KIRP) and lung squamous cell carcinoma (LUSC)

    • ADRA2C may influence prognosis in adrenocortical carcinoma (ACC), glioblastoma multiforme and lower grade glioma (GBM-LGG), and uveal melanoma (UVM)

  • Schizophrenia-associated alterations:

    • Increased ADRA2C mRNA expression in postmortem dorsolateral prefrontal cortex of schizophrenia subjects

    • These alterations may contribute to dysregulated noradrenergic signaling in schizophrenia

  • Differential activation states:

    • Alpha-2C ARs play a more prominent role during states of low endogenous noradrenaline activity

    • This suggests that Alpha-2C AR function may become particularly important under conditions of noradrenergic dysregulation

What methods are optimal for investigating Alpha-2C AR expression in cancer models?

Investigation of Alpha-2C AR in cancer requires specialized approaches:

  • RNA sequencing analysis:

    • Utilizing RNA-seq datasets from resources like The Cancer Genome Atlas (TCGA) database

    • Analysis across multiple cancer types to identify differential expression patterns

  • Bioinformatics techniques:

    • R programming for statistical analysis

    • Single-cell sequencing data analysis to characterize cell-type specific expression patterns

    • Correlation with clinical parameters to understand prognostic significance

  • Functional validation:

    • Cell migration assays to assess ADRA2C's role in cancer cell motility

    • Immunohistochemistry in both cancer cell lines and animal models

    • Experimental validation in specific cancer types such as glioblastoma multiforme (GBM)

These methodological approaches provide a comprehensive framework for investigating the complex roles of Alpha-2C adrenergic receptors in both normal physiology and pathological conditions, offering valuable insights for basic research and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.