Recombinant Rat Amphiregulin (Areg)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Rat Amphiregulin exists as a 248-amino acid type I transmembrane precursor protein . The bioactive form is released through proteolytic cleavage, with recombinant versions often containing COOH-terminal extensions to enhance receptor binding affinity . Key structural features include:

FeatureRat AREGMouse AREG (Reference)Human AREG (Reference)
Amino acid length248 residues248 residues 252 residues
EGF-like domains11 1
Receptor affinityEGFREGFR EGFR
Glycosylation sitesO-linkedO-linked N/O-linked

Recombinant forms (rAREG) are typically produced in E. coli with bioactivity confirmed through fibroblast proliferation assays . COOH-terminal extended variants (e.g., rAR87, rAR92) show 14-55x greater bioactivity than truncated forms .

Tissue Repair and Fibrosis

  • Lung Repair: In murine models, rAREG accelerates alveolar repair by activating integrin-αV on pericytes, triggering TGF-β release and myofibroblast differentiation .

  • Fibrosis Promotion: Bone marrow-derived CD11c+ cells secrete AREG to drive fibroblast proliferation via telomerase reverse transcriptase (TERT) induction .

Cellular Proliferation

  • Dual Role: While inhibiting some carcinomas, rAREG stimulates keratinocytes, astrocytes, and mammary epithelium .

  • Mechanism: EGFR/ERK1/2 signaling dominates, with hyperoxia models showing enhanced ERK phosphorylation in lung endothelial cells .

Table 1: Experimental Outcomes of rAREG Administration

Model SystemInterventionOutcomeCitation
Bleomycin-induced lung fibrosis (Mouse)AREG-neutralizing antibodyReduced collagen deposition, impaired TERT activation
N. brasiliensis infection (Mouse)rAREG injectionRestored vascular barrier function, increased αSMA+ myofibroblasts
CCl4-induced liver injury (Mouse)Areg −/− knockoutDelayed blood barrier restoration
Primary lung fibroblasts (Human)10 ng/mL rAREG3x proliferation boost in IPF-derived cells vs. controls

Production and Bioactivity

  • Expression Systems: E. coli-derived rAREG achieves >97% purity via chromatographic methods .

  • Bioactivity Metrics:

    • Effective dose (ED50): 5-15 ng/mL in Balb/3T3 fibroblast assays

    • Superior activity: 98-aa recombinant forms outperform shorter isoforms by 5-10x

Comparative Pathophysiological Roles

  • Protective vs. Pathogenic:

    • Beneficial: Accelerates epithelial recovery post-injury through ATP-mediated macrophage signaling .

    • Detrimental: Drives fibrotic remodeling in chronic agricultural dust exposure models .

Research Gaps and Opportunities

  1. Species-Specific Data: No rat-specific in vivo studies were identified; current understanding relies on murine homology .

  2. Therapeutic Targeting: EGFR inhibitors (e.g., PD153035 HCl) block AREG-induced TERT expression, suggesting antifibrotic potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Areg; Sdgf; Amphiregulin; AR; Schwannoma-derived growth factor; SDGF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
97-243
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA
Uniprot No.

Target Background

Function
Amphiregulin (AREG) serves as a ligand for the EGF receptor (EGFR). It functions as an autocrine growth factor, stimulating cell proliferation in a wide range of target cells, including astrocytes, Schwann cells, and fibroblasts.
Gene References Into Functions
  1. Reports indicate elevated AREG transcript and protein levels in the lungs of rodents with DA-induced bronchiolitis obliterans. PMID: 24816162
  2. Estrogen and progesterone have been shown to enhance cell proliferation in both normal glands and mammary cancers through increased production of amphiregulin. PMID: 21258428
  3. AREG may play a significant role in the ovulatory process of cycling rats, as well as in the induction of ovulation in immature rats. PMID: 15291759
  4. Research indicates that the expression of amphiregulin (AR), a member of the epidermal growth factor (EGF) family, is rapidly and significantly upregulated by PTH in several osteoblastic cell lines and bone tissues. PMID: 15509566
  5. Findings suggest that Amphiregulin acts as a resistance factor for glioma cells against delta9-Tetrahydrocannabinol-induced apoptosis. PMID: 19229996

Show More

Hide All

Database Links
Protein Families
Amphiregulin family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is rat Amphiregulin and how does it compare structurally to human and mouse orthologs?

Rat Amphiregulin is a member of the epidermal growth factor (EGF) family that functions as an autocrine growth factor and mitogen for various cell types. Structurally, rat Amphiregulin shares approximately 81% amino acid sequence homology with mouse Amphiregulin and about 69% with the human ortholog . Like other EGF family members, rat Amphiregulin contains one EGF-like domain in its extracellular region and is synthesized as a type I transmembrane precursor protein . The bioactive form is released through proteolytic cleavage of the extracellular domain.

SpeciesFull-length proteinCommon recombinant fragmentSequence homology to rat
Rat248 amino acidsTypically similar to mouse (Ser94-Lys191)100%
Mouse248 amino acidsSer94-Lys19181%
Human252 amino acidsSer101-Lys19869%

What are the functional characteristics of recombinant rat Amphiregulin?

Recombinant rat Amphiregulin functions as a ligand for the EGF receptor (EGFR), triggering receptor dimerization and activation of downstream signaling pathways. Its biological activity is typically measured using cell proliferation assays with responsive cell lines such as mouse embryonic fibroblast 3T3 cells, where the effective dose for 50% maximal response (ED50) is generally in the range of 0.5-20 ng/mL .

Functionally, rat Amphiregulin:

  • Stimulates proliferation of keratinocytes, mammary epithelial cells, fibroblasts, astrocytes, and glial cells

  • Functions as a growth inhibitor for certain tumor cell lines

  • Mediates tissue repair processes through activation of integrin-αV on pericytes

  • Participates in cross-talk between immune cells and tissue-resident cells during inflammation and repair

What expression systems are optimal for producing biologically active recombinant rat Amphiregulin?

While the search results don't specifically detail expression systems for rat Amphiregulin, we can infer from mouse and human Amphiregulin production methods. E. coli is the most commonly used expression system for producing recombinant Amphiregulin . The bacterial expression system offers advantages of high yield and cost-effectiveness but lacks post-translational modifications.

For producing biologically active rat Amphiregulin:

  • The recombinant protein typically includes only the bioactive EGF-like domain

  • Proper protein refolding protocols are essential to ensure correct disulfide bond formation

  • Purification typically involves affinity chromatography followed by size exclusion chromatography

  • Endotoxin removal is critical for in vivo applications and many in vitro experiments (target <1.0 EU/μg)

What are the optimal reconstitution and storage conditions for maintaining recombinant rat Amphiregulin activity?

For optimal activity preservation:

Reconstitution protocol:

  • Reconstitute lyophilized Amphiregulin at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin as a carrier protein

  • Allow protein to dissolve completely by gentle swirling rather than vortexing

  • Filter sterilize through a 0.2 μm filter if necessary

Storage conditions:

  • Store lyophilized protein at -70°C for maximum stability

  • Store reconstituted protein in working aliquots at 2-8°C for up to one month or at -20°C for up to six months with a carrier protein

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles

  • For long-term storage, prepare small single-use aliquots to minimize freeze-thaw cycles

How can I verify the biological activity of recombinant rat Amphiregulin in my experimental system?

Multiple complementary approaches can be used to verify Amphiregulin activity:

Cell proliferation assay:

  • Seed mouse embryonic fibroblast 3T3 cells in 96-well plates at 3-5×10³ cells/well

  • After attachment, treat cells with serial dilutions of recombinant Amphiregulin (0.1-100 ng/mL)

  • Incubate for 48-72 hours and measure proliferation using MTT, crystal violet, or BrdU incorporation

  • Calculate ED50 value, which should be approximately 0.5-20 ng/mL for active protein

EGFR phosphorylation assay:

  • Treat EGFR-expressing cells with recombinant Amphiregulin for 5-15 minutes

  • Lyse cells and analyze EGFR phosphorylation by Western blot

  • Active Amphiregulin will induce robust phosphorylation of EGFR at multiple tyrosine residues

Functional assay specific to your research context:
Based on research by Monticelli et al. (2011) and others cited in search result , Amphiregulin's activity can be verified through its ability to enhance tissue repair processes. For instance, in lung injury models, active Amphiregulin would improve restoration of lung function and blood vessel integrity .

What are the optimal working concentrations for different experimental applications?

Optimal concentrations vary by application:

ApplicationRecommended concentration rangeNotes
Cell proliferation assays0.5-50 ng/mLLower range for responsive cell lines (e.g., fibroblasts), higher for less responsive cells
Receptor activation studies1-20 ng/mLFor studying acute signaling events (5-30 min)
Differentiation assays5-100 ng/mLHigher concentrations may be needed for sustained effects
Tissue repair models1-10 μg per animalBased on in vivo injection protocols from animal studies
Co-culture systems10-50 ng/mLFor studying cell-cell interactions mediated by Amphiregulin

Always perform dose-response experiments in your specific experimental system, as optimal concentrations can vary depending on cell type, culture conditions, and experimental endpoints.

How does recombinant Amphiregulin contribute to tissue repair mechanisms and what signaling pathways are involved?

Recombinant Amphiregulin plays a crucial role in tissue repair through multiple mechanisms, as evidenced in search result :

Primary mechanism: Macrophage-Pericyte Axis
Amphiregulin expressed by macrophages, particularly after stimulation with ATP or LPS, activates integrin-αV-containing complexes on pericytes through an "inside-out" activation mechanism involving sustained phospholipase-Cγ (PLCγ) signaling . This activation leads to:

  • Enhanced binding of TGF-β latent associated protein (LAP) to integrin-αV

  • Release of bioactive TGF-β from its latent form

  • Induction of pericyte differentiation into myofibroblasts (marked by increased αSMA expression)

  • Promotion of tissue repair and restoration after injury

This mechanism was fully inhibited when either integrin-αV was blocked using the antibody RMV-7 or when PLCγ signaling was inhibited using U-73122 .

Experimental evidence:
In models of acute lung damage after Nippostrongylus brasiliensis infection, Amphiregulin-deficient (Areg−/−) mice showed:

  • Delayed restoration of lung function

  • Diminished restoration of blood vessel integrity

  • Reduced transcriptional expression of collagen 1α types I and III

  • Decreased expression of αSMA, a marker of myofibroblast differentiation

Importantly, all these deficiencies were fully reversed by injection of recombinant Amphiregulin (rAREG) .

What are the methodological considerations for studying Amphiregulin's role in immune regulation?

When investigating Amphiregulin's immunoregulatory functions, consider these methodological approaches:

Experimental models:

  • Infection models: N. brasiliensis lung infection model allows assessment of Amphiregulin's role in tissue repair after pathogen-induced damage

  • Chemical injury models: Carbon tetrachloride (CCl₄) induced liver damage serves as another model system to study Amphiregulin's role in tissue repair

  • Cell-specific knockout systems: Lyz2cre × Areg fl/fl mice (with macrophage-specific Amphiregulin deletion) can help delineate the specific contribution of macrophage-derived Amphiregulin

Key analytical approaches:

  • Co-culture systems: Co-culture of alveolar macrophages with primary pericytes demonstrates the direct effect of macrophage-derived Amphiregulin on pericyte differentiation

  • Flow cytometry: For analyzing integrin-αV activation and LAP binding to pericytes

  • Transcriptional analysis: Quantification of repair-associated genes (collagen 1α types I and III, αSMA)

  • Functional recovery assessment: Measurement of tissue function restoration (e.g., lung function parameters, vascular permeability)

Critical controls:

  • Amphiregulin knockout/knockdown models

  • Blocking antibodies against EGFR, integrin-αV, or TGF-β

  • Chemical inhibitors of key signaling pathways (e.g., PLCγ inhibitor U-73122)

  • Recombinant Amphiregulin rescue experiments

Why might I observe variability in cellular responses to recombinant Amphiregulin treatment?

Variability in cellular responses can stem from multiple factors:

Protein-related factors:

  • Protein denaturation due to improper handling or storage

  • Batch-to-batch variability in recombinant protein production

  • Endotoxin contamination interfering with cellular responses (ensure levels are <1.0 EU/μg)

Experimental design factors:

  • Cell culture density (optimal responsiveness typically occurs at 40-70% confluence)

  • Serum levels in media (high serum can mask Amphiregulin effects)

  • Passage number of cell lines (receptor expression can change with continued passaging)

  • Presence of other growth factors in the experimental system

Cell-intrinsic factors:

  • Variable EGFR expression levels across cell types and conditions

  • Differential expression of integrin-αV complexes, affecting secondary responses

  • Variations in PLCγ signaling capacity among different cell types

  • Pre-existing activation state of the EGFR pathway

To minimize variability, standardize cell culture conditions, use low-passage cells, reduce serum levels during treatment phases, and include appropriate positive controls (e.g., EGF treatment).

How can I distinguish between direct effects of Amphiregulin via EGFR and indirect effects through the integrin-αV/TGF-β pathway?

Based on findings in search result , Amphiregulin can mediate effects through both direct EGFR activation and indirect mechanisms involving integrin-αV activation and TGF-β release. To distinguish between these pathways:

Experimental approach to dissect direct vs. indirect mechanisms:

  • Temporal analysis:

    • Direct EGFR signaling: Rapid responses (minutes to hours)

    • Integrin-αV/TGF-β pathway: Delayed responses (hours to days)

  • Selective inhibition strategy:

PathwayInhibitorExpected outcome if pathway is involved
EGFREGFR-specific inhibitors (AG1478, erlotinib)Blocks immediate Amphiregulin effects
Integrin-αVRMV-7 (anti-integrin-αV antibody)Blocks LAP binding and subsequent TGF-β activation
PLCγU-73122 (PLCγ inhibitor)Prevents integrin-αV "inside-out" activation
TGF-βAnti-TGF-β neutralizing antibodiesBlocks effects mediated through TGF-β release
  • Gene expression analysis:

    • EGFR pathway: Monitor immediate-early response genes (e.g., c-fos, EGR1)

    • TGF-β pathway: Analyze SMAD-dependent gene expression (e.g., SERPINE1, CTGF)

  • Biochemical verification:

    • Use co-immunoprecipitation to detect interactions between Amphiregulin and EGFR

    • Assess phosphorylation of pathway-specific components (EGFR vs. SMAD proteins)

  • Functional readouts:

    • Cell proliferation (primarily EGFR-dependent)

    • Myofibroblast differentiation (integrin-αV/TGF-β dependent)

The experimental approaches outlined in search result , particularly the use of the integrin-αV blocking antibody RMV-7 and the PLCγ inhibitor U-73122, provide powerful tools for dissecting these pathways.

What are the implications of Amphiregulin's role in the macrophage-pericyte axis for developing new therapeutic approaches?

The discovery of Amphiregulin's role in activating the integrin-αV/TGF-β pathway in pericytes opens several therapeutic possibilities:

Potential therapeutic applications:

  • Enhanced tissue repair: Recombinant Amphiregulin administration could accelerate healing in conditions characterized by impaired tissue repair

  • Fibrosis modulation: Targeted inhibition of Amphiregulin could potentially limit excessive fibrosis in chronic inflammatory conditions

  • Macrophage-directed therapies: Enhancing macrophage production of Amphiregulin could promote tissue repair in specific contexts

Considerations for therapeutic development:

  • Delivery strategies: Local vs. systemic administration of recombinant Amphiregulin

  • Timing of intervention: Early administration may promote repair while late administration might exacerbate fibrosis

  • Context-specificity: Effects may vary depending on tissue type and injury mechanism

Experimental models for therapeutic development:

  • Acute injury models (e.g., N. brasiliensis infection, CCl₄-induced liver damage)

  • Chronic injury models (e.g., bleomycin-induced pulmonary fibrosis)

  • Regenerative medicine applications (e.g., wound healing, tissue engineering)

How can I design experiments to investigate the cross-talk between Amphiregulin and other growth factors in tissue repair?

To investigate growth factor cross-talk in tissue repair processes:

Experimental design considerations:

  • Multi-factorial treatment design:

    • Treat cells/tissues with Amphiregulin alone, other growth factors alone, and combinations

    • Use factorial experimental designs to identify synergistic or antagonistic interactions

    • Include appropriate controls for each growth factor and combination

  • Time-course analyses:

    • Short-term (minutes to hours): Focus on receptor activation and immediate signaling

    • Medium-term (hours to days): Analyze gene expression changes and cellular phenotypes

    • Long-term (days to weeks): Assess functional tissue repair outcomes

  • Key growth factors to investigate in combination with Amphiregulin:

    • TGF-β family members (based on the established connection)

    • Other EGF family ligands (potential receptor competition)

    • PDGF (relevant for pericyte biology)

    • FGF family members (important in tissue repair)

  • Advanced analytical approaches:

    • Single-cell RNA sequencing to dissect cellular heterogeneity and response patterns

    • Phosphoproteomics to map signaling network integration

    • Live cell imaging with pathway-specific reporters to track dynamic responses

    • Spatial transcriptomics to analyze growth factor interactions in the tissue context

  • Genetic manipulation strategies:

    • CRISPR-mediated knockout of specific receptors or downstream components

    • Inducible expression systems for temporal control

    • Cell-type specific manipulation using Cre-lox systems (e.g., Lyz2cre for macrophages)

These experimental approaches will help elucidate the complex interplay between Amphiregulin and other growth factors in coordinating tissue repair responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.