Recombinant Rat Androgen-dependent TFPI-regulating protein (Adtrp)

Shipped with Ice Packs
In Stock

Description

Vascular Integrity and Wnt Signaling

ADTRP deficiency in rodent models leads to:

  • Vascular leakage due to reduced VE-cadherin (0.46-fold) and claudin-5 (0.39-fold) .

  • Aberrant Wnt/β-catenin signaling, increasing matrix metallopeptidase-9 (MMP-9) expression in endothelial and mast cells .

  • Perivascular inflammation characterized by mast cell accumulation and extracellular matrix degradation .

Gene/ProteinExpression Change (Adtrp−/− vs. WT)Functional Impact
Cdh5 (VE-cadherin)↓ 0.46-foldEndothelial junction instability
Cldn5 (claudin-5)↓ 0.39-foldBarrier dysfunction
Mmp9↑ 2.5–3.0-foldMatrix degradation
Klf4↓ 0.18-foldReduced junction stability

Coagulation Regulation

ADTRP modulates Tissue Factor Pathway Inhibitor (TFPI), the primary inhibitor of the tissue factor-dependent coagulation pathway . Key mechanisms include:

  • Enhancing TFPI activity in endothelial cells under androgen stimulation .

  • Association with deep vein thrombosis and coronary artery disease via single-nucleotide polymorphisms (e.g., rs6903956) .

Transcriptional Control

  • Androgen-dependent: Testosterone upregulates ADTRP through androgen-response elements .

  • PPARα/γ activation: Wy14643 (PPARα agonist) and rosiglitazone (PPARγ agonist) induce hepatic and adipocyte Adtrp expression, respectively .

Tissue Distribution

  • Highest expression in liver, brown adipose tissue (BAT), and kidneys .

  • Moderate levels in vascular endothelium and macrophages within atherosclerotic plaques .

Biosynthesis

  • Expression system: E. coli .

  • Tags: N-terminal 10xHis and C-terminal Myc for affinity purification .

  • Purity: >90% via SDS-PAGE .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Adtrp; Aa2-020; Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP; Liver regeneration-related protein LRRG140
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Adtrp
Target Protein Sequence
MTKTTTCLYHFVVLNWYIFLNYYIPQIGKDEEKLKEFHDGGRSKYLTLLNLLLQAVFFGV ACLDDVLKRVIGRKDIKFITYFRDLLFTTLAFPLSTFVFLVFWSLFHYDRSLVYPKGLDD FFPAWVNHAMHTSIFPFSLAETVLRPHNYPSKKLGLSLLGACNFAYIIRILWRYVQTGNW VYPVFASLSPLGIILFFSASYILSASLYLFGEKINHWKWGATVKPRMKKN
Uniprot No.

Target Background

Function
This protein hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs) but does not act on other major lipid classes. It demonstrates a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. In endothelial cells (in vitro), this protein regulates the expression and anticoagulant activity of the inhibitor TFPI.
Database Links

KEGG: rno:361228

UniGene: Rn.16893

Protein Families
AIG1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the physiological function of Adtrp in endothelial cells?

Adtrp (Androgen-dependent Tissue Factor Pathway Inhibitor Regulating Protein) plays a crucial role in regulating the expression and anticoagulant activity of TFPI in endothelial cells. Research has shown that Adtrp supports TFPI's ability to inhibit tissue factor (TF)-dependent coagulation pathways. When Adtrp is downregulated through post-transcriptional silencing in endothelial cells, there is a concomitant reduction in TFPI mRNA expression and cell surface TFPI antigen and activity .

This regulatory function is particularly significant because TFPI is notoriously non-responsive to transcriptional regulation under normal conditions. Adtrp appears to actively preserve the anticoagulant potential of TFPI on the endothelial cell surface, affecting not just the quantity but also the functionality of TFPI . The interaction between Adtrp and TFPI represents a novel mechanism through which androgen-responsive genes can influence coagulation processes.

How can researchers effectively create and validate Adtrp knockout models?

To create effective Adtrp knockout models, researchers should consider the gene structure carefully. As demonstrated in previous studies, exons 2 to 5 of the Adtrp gene share in-frame splice junctions, meaning removal of only one of exons 2, 3, or 4 would not produce a frameshift event .

A validated approach involves using a bacterial artificial chromosome targeting vector designed to introduce: (1) LoxP1 site in intron 1; (2) LoxP2 site and FRT-flanked Neo-resistance cassette in intron 2; and (3) additional genetic modifications to ensure complete functional knockout . This strategy ensures that any residual mRNA would not produce a functional polypeptide.

When validating the knockout model, researchers should assess both mRNA and protein expression levels, as well as functional assays related to TFPI activity and vascular development. The use of both mouse and zebrafish models provides complementary information, as demonstrated in previous studies where both models showed consistent phenotypes of vascular malformations when Adtrp was inhibited .

What phenotypic changes can be expected in Adtrp-deficient animal models?

Adtrp-deficient animal models consistently display vascular malformations, particularly in the low-pressure vasculature. These include:

  • Dilation and tortuosity of vessels

  • Perivascular inflammation

  • Increased vascular permeability

  • Microhemorrhages

  • Partially penetrant lethality

  • Decreased endothelial cell junction components (VE-cadherin and claudin-5)

  • Modest decrease in TFPI antigen and activity

  • Increased tail bleeding time and volume in young adult mice

At the cellular level, vascular lesions in newborn Adtrp-deficient mice show accumulation of mast cells, decreased extracellular matrix content, and deficient perivascular cell coverage . These phenotypic changes provide valuable endpoints for assessing interventions or genetic modifications in Adtrp-related research.

What techniques are recommended for measuring Adtrp protein levels in tissue samples?

Immunohistochemistry or immunofluorescence can also be used to visualize the localization of Adtrp protein in tissues, particularly in vascular structures. For more sensitive detection, quantitative mass spectrometry-based proteomics approaches may be considered, especially when analyzing tissues with lower expression levels.

When analyzing Adtrp in the context of its functional relationship with TFPI, co-immunoprecipitation experiments can provide valuable information about protein-protein interactions. Flow cytometry can be used to analyze cell surface expression in isolated cells from tissues of interest.

How does Adtrp regulate Wnt/β-catenin signaling pathways in vascular development?

Adtrp functions as a negative regulator of canonical Wnt signaling, acting at membrane events downstream of low-density lipoprotein receptor-related protein 6 (LRP6) and upstream of glycogen synthase kinase 3 beta . Cell-based reporter assays have confirmed this regulatory function, providing a mechanistic link between Adtrp and Wnt/β-catenin signaling.

In the absence of Adtrp, aberrant/ectopic Wnt/β-catenin signaling occurs in vivo, as demonstrated in both newborn mice and zebrafish embryos . This dysregulation leads to upregulation of matrix metallopeptidase-9 (MMP-9) in endothelial cells and mast cells, which contributes to the vascular phenotypes observed in Adtrp-deficient models.

To experimentally investigate this regulation, researchers can employ TOPflash/FOPflash reporter assays to measure β-catenin-dependent transcriptional activity in the presence or absence of Adtrp. Additionally, analyzing the phosphorylation status of key Wnt pathway components (such as LRP6, GSK3β, and β-catenin) can provide insights into the specific point of Adtrp's regulatory action in the signaling cascade.

What is the relationship between Adtrp, MMP-9 expression, and vascular integrity?

Adtrp deficiency leads to upregulation of matrix metallopeptidase (MMP)-9 in endothelial cells and mast cells . This relationship has been demonstrated to be downstream of the canonical Wnt signaling pathway, as Wnt-pathway inhibition reverses the increased MMP-9 expression induced by Adtrp deficiency .

The upregulation of MMP-9 contributes to the vascular phenotypes observed in Adtrp-deficient models through multiple mechanisms:

  • Degradation of extracellular matrix components, reducing vascular stability

  • Disruption of cell-cell junctions, leading to increased vascular permeability

  • Promotion of inflammatory cell recruitment, particularly mast cells

  • Alteration of vascular remodeling processes

To study this relationship experimentally, researchers can use gelatin zymography to assess MMP-9 activity, immunohistochemistry to localize MMP-9 expression in vascular lesions, and specific MMP-9 inhibitors to determine if blocking MMP-9 activity can rescue the vascular phenotypes in Adtrp-deficient models.

How do TF/TFPI ratios relate to organ dysfunction in the context of Adtrp research?

The relationship between tissue factor (TF), tissue factor pathway inhibitor (TFPI), and organ dysfunction provides important context for Adtrp research. Studies have examined associations between TF/TFPI ratios and various organ dysfunctions using generalized estimating equation (GEE) models, with the following findings:

ParameterTF/TFPI bp
ARDS stage0.313 (− 0.301–0.926)0.318
KDIGO AKI stage− 0.483 (− 1.034–0.068)0.086
Troponin T0.531 (0.309–0.754)< 0.001
NT-Pro-BNP0.398 (− 0.326–1.112)0.282
Bilirubin− 0.226 (− 0.699–0.248)0.35
Lactate− 0.176 (− 0.38–0.028)0.09
SOFA− 0.575 (− 2.02–0.869)0.435
Respiratory SOFA0.151 (− 0.372–0.673)0.572
CNS SOFA0.079 (− 0.35–0.509)0.717
Cardiovascular SOFA− 0.21 (− 0.729–0.308)0.427
Renal SOFA− 0.076 (− 0.546–0.393)0.75
Coagulation SOFA− 0.351 (− 0.815–0.112)0.137
Liver SOFA− 0.588 (− 1.27–0.095)0.091
D-Dimer− 0.213 (− 0.478–0.051)0.114
INR0.032 (− 0.067–0.132)0.522
INR category (< 1.2 vs. ≥ 1.2)0.075 (− 0.449–0.598)0.779
ISTH non-overt DIC category (max)− 0.292 (− 1.13–0.546)0.495
ISTH overt DIC category (max)− 0.205 (− 0.378–0.788)0.491

Researchers investigating Adtrp should consider these relationships, as Adtrp regulates TFPI expression and function, potentially influencing the TF/TFPI ratio and subsequent organ effects. Experimental designs should include assessments of cardiac function when studying Adtrp deficiency models.

What experimental approaches can resolve contradictory findings regarding systemic versus local TFPI regulation by Adtrp?

Contradictory findings regarding TFPI regulation at systemic versus local levels present a challenge in Adtrp research. Studies have shown that systemic levels of TF and TFPI might not reflect the imbalance observed at the cellular level . To resolve these contradictions, researchers should employ multiple complementary approaches:

  • Tissue-specific conditional knockout models: Generate endothelial-specific, myeloid-specific, or other cell-type-specific Adtrp knockout models to differentiate between cell-autonomous and non-cell-autonomous effects.

  • Intravital microscopy: Use fluorescently labeled TFPI and TF to directly visualize their distribution and colocalization in live animals under different conditions.

  • Single-cell analysis: Employ single-cell RNA sequencing and proteomics to examine cell-specific changes in TFPI regulation in the presence or absence of Adtrp.

  • Activity versus antigen measurements: Measure both TFPI protein levels (antigen) and functional activity, as discrepancies between these measurements can provide insights into post-translational regulation.

  • Microvascular sampling: Develop techniques to sample from specific vascular beds to compare local versus systemic TFPI levels in the same animal.

These approaches can help differentiate between cellular-level imbalances and systemic alterations, potentially explaining why increased systemic TFPI levels might be observed in conditions associated with endothelial dysfunction, despite local TFPI deficiency at the cellular level .

How can researchers differentiate between androgen-dependent and androgen-independent functions of Adtrp?

  • Mutation of AREs: Create targeted mutations in the half-AREs (AGAACA and TGTTCT) in the Adtrp promoter to generate models where Adtrp expression is uncoupled from androgen regulation.

  • Hormone manipulation experiments: Compare Adtrp function in gonadectomized animals with and without androgen replacement to identify which functions persist in the absence of androgens.

  • Cell-type specific analyses: Examine Adtrp function in cell types with different levels of androgen receptor expression to identify cell types where Adtrp function is androgen-independent.

  • Temporal studies during development: Analyze Adtrp function during developmental windows with different androgen levels to identify critical periods of androgen dependence.

  • Protein domain analysis: Create truncated or mutated versions of Adtrp protein to identify functional domains that operate independently of androgen-induced expression changes.

These approaches will help clarify which aspects of Adtrp function are directly regulated by androgens and which represent intrinsic activities of the protein that occur regardless of how its expression is induced.

What are the optimal methods for studying Adtrp's role in coagulation pathways?

To effectively study Adtrp's role in coagulation pathways, researchers should employ a combination of methodologies:

In vitro coagulation assays: Factor Xa generation assays have been successfully used to demonstrate that ADTRP actively preserves the anticoagulant potential of TFPI on endothelial cell surfaces. In experiments with ADTRP-silenced cells, TFPI inhibited only 12% of total FXa generated, compared to 55% in control cells .

Immunofluorescence colocalization studies: Triple overlap analysis of TF/TFPI/Cav-1 provides morphological confirmation of functional assays. Cell surface TFPI activity positively correlates with the percentage of TF that colocalizes with both cell surface TFPI and sub-membrane Cav-1 .

In vivo bleeding time assays: Tail bleeding time and volume measurements in Adtrp-deficient mice provide functional assessment of hemostatic alterations .

Flow chamber assays: Using microfluidic devices with endothelial cells under flow conditions can better mimic physiological conditions for studying Adtrp's role in coagulation.

What controls should be included when analyzing Wnt signaling alterations in Adtrp research?

When analyzing Wnt signaling alterations in Adtrp research, several controls are essential:

  • Positive controls: Include known Wnt pathway activators (e.g., Wnt3a, GSK3β inhibitors) to establish the dynamic range of the assay system.

  • Pathway specificity controls: Analyze both canonical (β-catenin-dependent) and non-canonical Wnt pathways to determine specificity of Adtrp's effects.

  • Rescue experiments: Test whether Wnt pathway inhibitors can reverse phenotypes caused by Adtrp deficiency, as was demonstrated with MMP-9 expression in zebrafish embryos .

  • Dose-response relationships: Establish dose-response relationships between Adtrp expression levels and Wnt signaling outputs to identify potential threshold effects.

  • Tissue/developmental stage controls: Include analyses at different developmental stages and in different tissues to account for context-dependent effects of Wnt signaling.

  • Genetic background controls: Ensure consistent genetic backgrounds when comparing Wnt signaling across different models, as genetic modifiers can influence Wnt pathway responsiveness.

These controls help establish the specificity and biological relevance of observed Wnt signaling alterations in Adtrp research.

How should researchers address the limitations of measuring systemic versus local TFPI levels?

Measuring systemic versus local TFPI levels presents significant challenges in Adtrp research. Studies have indicated that "systemic levels of TF and TFPI might not reflect the imbalance of TF/TFPI observed on a cellular level" and that "measuring systemic levels might not be appropriate to identify patients that might benefit from TFPI therapy" . Researchers should address these limitations through several approaches:

What are promising therapeutic targets based on the Adtrp-Wnt-MMP9 axis?

The Adtrp-Wnt-MMP9 regulatory axis presents several promising therapeutic targets for vascular pathologies:

  • Wnt pathway modulators: Since Adtrp negatively regulates canonical Wnt signaling, Wnt inhibitors may compensate for Adtrp deficiency. Specific inhibitors targeting events downstream of LRP6 and upstream of GSK3β would be most relevant based on Adtrp's point of action in the pathway .

  • MMP-9 inhibitors: Targeted inhibition of MMP-9 could directly address the extracellular matrix degradation and vascular permeability issues caused by Adtrp deficiency. Both small molecule inhibitors and more specific antibody-based approaches could be explored .

  • Mast cell stabilizers: Given the accumulation of mast cells in vascular lesions of Adtrp-deficient animals, mast cell stabilizers might reduce local inflammation and MMP-9 release .

  • Junction-stabilizing compounds: Agents that stabilize endothelial cell junctions could counteract the decreased VE-cadherin and claudin-5 observed in Adtrp deficiency .

  • Recombinant Adtrp or mimetic peptides: Development of recombinant Adtrp protein or peptides mimicking its functional domains could directly replace the deficient protein in pathological conditions.

Each of these approaches would require validation in appropriate animal models before clinical translation, with careful attention to potential off-target effects given the widespread importance of Wnt signaling in multiple tissues.

How might Adtrp research inform understanding of sex differences in vascular diseases?

Given that Adtrp is androgen-regulated, it represents an important factor potentially contributing to sex differences in vascular diseases. Future research should explore:

  • Sex-specific phenotypes in Adtrp deficiency: Compare male and female animals with Adtrp deficiency to identify sex-specific differences in vascular phenotypes and severity.

  • Interaction with estrogen signaling: Investigate potential cross-talk between androgen regulation of Adtrp and estrogen signaling pathways, which might explain sex differences in vascular protection.

  • Hormonal interventions: Test whether manipulation of sex hormone levels affects Adtrp expression and function differently in males and females.

  • Polymorphisms and human populations: Analyze whether Adtrp polymorphisms associate with vascular diseases differently in men versus women across different populations.

  • Age-dependent effects: Examine how age-related changes in sex hormone levels affect Adtrp function, particularly during key transitions like puberty and menopause/andropause.

Research in this area could provide mechanistic insights into well-documented but poorly understood sex differences in vascular diseases like coronary artery disease, deep vein thrombosis, and stroke.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.