Recombinant Rat Apolipoprotein L domain-containing protein 1 (Apold1)

Shipped with Ice Packs
In Stock

Description

Introduction

Apolipoprotein L domain-containing protein 1 (Apold1), also known as vascular early response gene (VERGE), is a protein encoded by the APOLD1 gene in humans . It was initially identified as an early response protein in endothelial cells, induced by ischemia, and is expected to regulate endothelial cell signaling and vascular function . Despite its early discovery, the function of Apold1 remains largely unexplored, with only a limited number of studies published on the topic . Apold1 is expressed primarily in endothelial cells and megakaryocytes/platelets . Recent research has begun to elucidate its roles in angiogenesis, vascular homeostasis, and endothelial function .

Gene and Protein Structure

The APOLD1 gene encodes a protein containing an apolipoprotein L domain . Apold1 is a modulator of endothelial barrier permeability and is required for proper organization of endothelial cell-cell junctions and the cytoskeleton . The protein's structure suggests a potential role in lipid binding and transport, similar to other apolipoproteins, though its specific lipid ligands and mechanisms of action are still under investigation.

Expression and Localization

Apold1 expression is largely restricted to the vasculature across various tissues, with endothelial cells showing high sensitivity to environmental factors . Studies have detected Apold1 at cell-cell junctions, specifically at VE-Cadherin-defined junctions of human dermal blood endothelial cells (HDBECs) in culture . Additionally, Apold1 is found in Weibel-Palade bodies (WPBs), which are endothelial cell-specific storage granules containing von Willebrand factor (VWF) and angiopoietin-2 (ANGPT2) .

Role in Angiogenesis

Apold1's role in angiogenesis has been investigated in both developmental and pathological contexts. Research indicates that Apold1 is dispensable for normal developmental angiogenesis but plays a crucial role in revascularization during recovery from ischemia . In vitro, Apold1 is activated in endothelial cells upon growth factor stimulation and hypoxia, intrinsically controlling endothelial cell proliferation but not migration . Studies using Apold1 knockout mice have demonstrated impaired recovery and revascularization after ischemic events such as photothrombotic stroke and femoral artery ligation . Furthermore, human tumor endothelial cells express high levels of Apold1, and its deletion in mice stunts the growth of melanoma tumors by limiting endothelial cell proliferation .

Impact on Endothelial Function and Vascular Homeostasis

Apold1 significantly impacts endothelial function and vascular homeostasis . Loss of Apold1 leads to endothelial dysfunction, affecting cell-cell junctions, cytoskeletal architecture, and WPBs . Specifically, silencing Apold1 in HDBECs results in a reduction of VWF and ANGPT2, impairing their storage in WPBs and leading to elevated levels of these proteins in the cell supernatant . The disruption of endothelial cell junctions and increased permeability caused by Apold1 loss may contribute to bleeding disorders .

7.1. Vascular Bleeding Disorders

Mutations in APOLD1 have been linked to inherited bleeding disorders . The loss of Apold1 results in dysmorphic endothelial cells with reduced cell-cell junctions and increased permeability, potentially leading to bleeding disorders .

7.2. Ischemic Conditions and Stroke

Apold1 is essential for functional revascularization during recovery from ischemia in the central nervous system and the periphery . In a mouse model of neonatal stroke, Apold1 knockout pups showed reduced angiogenesis after stroke and impaired long-term functional recovery .

7.3. Tumor Angiogenesis

Human tumor endothelial cells express strikingly higher levels of Apold1, and Apold1 deletion in mice reduces tumor growth by limiting endothelial cell proliferation . This suggests that Apold1 could be a potential target for anti-angiogenic cancer therapies.

8.1. Cell-Type Markers Used for Single-Cell RNA-Seq Data Analysis

Cell TypeMarkers
Endothelial CellsPecam1 (Cd31), Cdh5 (VE-Cadherin), vWF
T CellsCd3d, Cd3e
B CellsCd79a, Cd79b
MacrophagesCd68, Csf1r
NeutrophilsS100a8, S100a9
FibroblastsCol1a1, Col1a2
Smooth Muscle CellsActa2, Myh11
Skeletal MuscleMyod1, Myog
Satellite CellsPax7

8.2. Plasma Levels of VWF and ANGPT in APOLD1-Deficient Patients

Patient IDVWF:Ag (%)ANGPT2 (pg/mL)ANGPT1 (pg/mL)Blood Group
PM418622311191A
PM612724901463A
PM9157N/AN/AA
PM1118619351135A
Normal Range<1501189 ± 772893 ± 457N/A

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Apold1; Verge; Apolipoprotein L domain-containing protein 1; Vascular early response gene protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Apold1
Target Protein Sequence
MEKWTAWEPQGADALRRFQGLLLDRRGRLHCQVLRLREVARRLERLRRRSLAANVAGSSL SAAGALAAIVGLSLSPVTLGASLVASAVGLGVATAGGAVTITSDLSLIFCNSREVRRVQE IAATCQDQMRELLSCLEFFCQWQGRGDRQLLQSGRDASMALYNSVYFIVFFGSRGFLIPR RAEGATKVSQAVLKAKIQKLSESLESCTGALDELSEQLESRVQLCTKAGRGHNLRNSPDL DAALFF
Uniprot No.

Target Background

Function
May be involved in angiogenesis. May play a role in activity-dependent changes in brain vasculature. May affect blood-brain barrier permeability.
Gene References Into Functions
  1. This study describes a novel immediate early gene selectively expressed in vascular endothelial cells. Findings suggest that Verge functions as a dynamic regulator of endothelial cell signaling and vascular function. [Verge] PMID: 15102925
Database Links

KEGG: rno:444983

UniGene: Rn.87679

Protein Families
Apolipoprotein L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present at low levels in brain vascular cells (at protein level).

Q&A

Advanced Research Questions

  • What phenotypes are observed in Apold1 knockout models and how do they inform our understanding of Apold1 function?

Apold1 knockout (Apold1-/-) mice exhibit several distinct phenotypes that illuminate the protein's function:

PhenotypeObservation in Apold1-/- miceReference
Arterial thrombosisShorter time to occlusion after photochemical injury (29.42 ± 2.74 min vs. 39.96 ± 3.86 min in WT)
Tissue factor activityIncreased in carotid arteries (27.31 ± 4.55 pM/g vs. 13.48 ± 3.20 pM/g in WT)
Platelet reactivityEnhanced collagen-induced aggregation (68.49 ± 6.88% vs. 40.46 ± 5.93% in WT)
PI3K/Akt activationReduced phosphorylation of Akt
Normal developmentDispensable for development; no effect on postnatal retinal angiogenesis
Ischemic recoveryDramatic impairments in recovery and revascularization after stroke and femoral artery ligation
Tumor growthStunted growth of subcutaneous B16 melanoma tumors with smaller, poorly perfused vessels

These phenotypes collectively suggest that while Apold1 is dispensable for normal development, it plays crucial roles in pathological angiogenesis and vascular homeostasis .

  • How does Apold1 deficiency affect arterial thrombosis, and what mechanisms are involved?

Apold1 deficiency results in a prothrombotic phenotype. In a photochemical injury model of carotid thrombosis, Apold1-/- mice exhibit:

  • Significantly shorter time to occlusion (29.42 ± 2.74 min vs. 39.96 ± 3.86 min in WT mice)

  • Increased tissue factor (TF) activity in carotid arteries (27.31 ± 4.55 pM/g vs. 13.48 ± 3.20 pM/g in WT)

  • Enhanced platelet reactivity to collagen stimulation, with:

    • Increased maximal aggregation (68.49 ± 6.88% vs. 40.46 ± 5.93%)

    • Increased rate of aggregation (47.13 ± 12.35 %/min vs. 16.79 ± 3.5 %/min)

    • Decreased lag phase (106.6 ± 21.73 s vs. 175.5 ± 24.05 s)

Mechanistically, this prothrombotic phenotype appears to involve reduced phosphorylation of Akt in the PI3K/Akt pathway, while MAPK activation remains unaffected . Interestingly, platelet count and volume are unchanged in Apold1-/- mice, indicating that the enhanced thrombotic tendency is due to functional changes rather than platelet numbers .

  • What role does Apold1 play in angiogenesis and recovery from ischemia?

Apold1 is a key regulator of angiogenesis specifically in pathological settings:

  • Developmental angiogenesis: Apold1 is dispensable for normal development and does not affect postnatal retinal angiogenesis or vascular networks in adult brain and muscle .

  • Pathological angiogenesis: Apold1-/- mice display:

    • Dramatic impairments in recovery and revascularization following photothrombotic stroke

    • Poor recovery after femoral artery ligation

    • Stunted growth of subcutaneous B16 melanoma tumors with smaller and poorly perfused vessels

Mechanistically, Apold1 is activated in endothelial cells upon growth factor stimulation and in hypoxic conditions. It intrinsically controls endothelial cell proliferation but not migration . This selective role in pathological angiogenesis makes Apold1 a promising candidate for clinical investigation, particularly for targeted therapies that might selectively affect pathological but not physiological angiogenesis.

  • How does APOLD1 regulate endothelial cell function at the subcellular level?

APOLD1 localizes to specific subcellular compartments in endothelial cells and regulates several key functions:

  • Cell junctions: APOLD1 localizes to endothelial cell contacts. Silencing of APOLD1 disrupts the cell junction-cytoskeletal interface, altering endothelial permeability .

  • Weibel-Palade bodies (WPBs): APOLD1 associates with von Willebrand factor (VWF) tubules within WPBs. APOLD1 depletion leads to:

    • Reformation of WPBs into autophagosome-like organelles

    • Spontaneous release of WPB contents (VWF and angiopoietin-2) into the extracellular medium

    • Impaired autophagy flux, which is essential for regulated WPB release

These findings indicate that APOLD1 maintains endothelial homeostasis by preserving cell junction integrity and regulating the storage and release of WPB contents, which are critical for vascular function.

  • What is the association between APOLD1 mutations and human disease?

A mutation in APOLD1 has been identified in a family with an inherited bleeding disorder:

  • The mutation (APOLD1:p.R49*) is a dominant heterozygous nonsense variant that segregated to affected family members across three generations .

  • Patients present with an atypical bleeding diathesis associated with episodic impaired microcirculation .

  • The clinical profile is unusual, potentially explained by:

    • Compromised vascular integrity resulting from excess plasma angiopoietin-2

    • Locally impaired availability of VWF

This contrasts with findings in Apold1-/- mice, which show a prothrombotic phenotype with higher platelet reactivity . This apparent contradiction might reflect species-specific differences or the distinction between complete knockout versus a specific mutation that could have dominant-negative effects.

  • What methodologies are optimal for producing and purifying recombinant Apold1 protein?

Based on established protocols for recombinant apolipoprotein production:

  • Expression system selection:

    • E. coli systems (such as BL21 DE3) can efficiently produce rat Apold1

    • HEK293 cells are suitable for producing properly folded mammalian Apold1

  • Vector design considerations:

    • pET30 expression vectors with N-terminal His-tags facilitate purification

    • The His-tag can be removed with specific proteases like IgA protease (Igase) from Neisseria gonorrhoeae, which is preferable as common proteases may cleave apolipoproteins at undesired sites

  • Storage and handling:

    • Recombinant Apold1 should be stored at -20°C/-80°C upon receipt

    • For extended storage, aliquoting is necessary to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution:

    • Lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C

  • What experimental applications are most suitable for recombinant Apold1 proteins and what controls should be implemented?

Recombinant Apold1 proteins are valuable tools for several experimental applications:

  • Functional studies:

    • Cell culture experiments to assess effects on endothelial permeability

    • Analysis of interaction with autophagy pathways

    • Investigation of effects on platelet aggregation

  • Protein-protein interaction studies:

    • Immunoprecipitation/Co-precipitation to identify binding partners

    • Pre-coupled magnetic beads can facilitate convenient and fast capture of target molecules with high specificity

  • Signaling pathway analysis:

    • Examining effects on PI3K/Akt and MAPK pathways

    • Evaluating impacts on tissue factor activity

Key experimental controls should include:

  • Wild-type recombinant protein as a positive control

  • Structurally similar but functionally distinct proteins as negative controls

  • Concentration-dependent studies to establish dose-response relationships

  • Comparison with endogenous Apold1 function in appropriate cell types

  • Validation of results across multiple experimental systems (in vitro and in vivo)

  • How do findings from Apold1-/- mice contrast with human APOLD1 mutations, and what explains these differences?

There are notable contradictions between mouse and human Apold1/APOLD1 deficiency phenotypes:

ParameterApold1-/- miceHuman APOLD1:p.R49* mutation
Thrombotic tendencyProthrombotic phenotypeBleeding disorder
Platelet functionIncreased reactivity to collagenAssociated with bleeding tendency
Vascular integrityNot directly assessedCompromised vascular integrity

These contradictions might be explained by:

  • Species-specific differences in Apold1 function (human APOLD1 has 348 amino acids while rat Apold1 has 246 amino acids)

  • Nature of the genetic alteration:

    • Complete knockout in mice vs. a specific truncating mutation (R49*) in humans

    • The R49* mutation may have dominant-negative effects rather than simple loss-of-function

  • Compensatory mechanisms:

    • Different compensatory pathways may exist in mice versus humans

    • Developmental compensation in constitutive knockout models versus acute disruption in human disease

  • Context-specific roles:

    • Apold1 may have different functions in different vascular beds or under different physiological stresses

    • The mutation in humans might affect specific functions while preserving others

Understanding these contrasts is crucial for translating findings from animal models to human disease implications .

Methodological Research Questions

  • What are the most effective protocols for studying Apold1 function in endothelial cells?

For studying Apold1 function in endothelial cells, researchers should consider these methodological approaches:

  • Gene expression manipulation:

    • siRNA-mediated APOLD1 depletion in human dermal blood endothelial cells has been successfully used to study morphology and function

    • CRISPR-Cas9 gene editing for stable knockout models

    • Overexpression studies using plasmid transfection

  • Endothelial functional assays:

    • Permeability assays using fluorescent tracers

    • Cell junction integrity assessment via immunofluorescence of VE-cadherin and other junction proteins

    • Weibel-Palade body exocytosis measurements using VWF and angiopoietin-2 as markers

    • Autophagy flux assessment using LC3 conversion and p62 degradation

  • Angiogenesis models:

    • In vitro: tube formation assays, scratch migration assays, spheroid sprouting assays

    • Ex vivo: aortic ring assay

    • In vivo: retinal angiogenesis, matrigel plug assay, tumor angiogenesis models

  • Stress response models:

    • Hypoxia chambers to mimic ischemia

    • Growth factor stimulation (VEGF, FGF2, Angiopoietin-2)

    • Flow studies to assess mechanotransduction responses

  • Localization studies:

    • Subcellular fractionation

    • Co-immunoprecipitation with junctional proteins and WPB components

    • Super-resolution microscopy to visualize precise subcellular distribution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.