Recombinant Rat Aquaporin-1 (Aqp1)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Rat Aqp1 is produced through heterologous expression systems, enabling detailed study of its biological roles. Key production methods include:

Expression Systems

Host SystemTag/ModificationPurification MethodPuritySource
E. coliN-terminal 6xHis-SUMO tagAffinity chromatography>90%
HEK293T cellsC-terminal Myc/DDK tagAnti-DDK affinity column>80%
  • Gene Cloning: The rat Aqp1 gene (UniProt ID: P29975) encoding residues 2–269 is cloned into plasmid vectors for expression .

  • Post-Expression Processing: SDS-PAGE and Western blotting confirm molecular weights of ~28 kDa (unglycosylated) and 35–38 kDa (glycosylated) .

Water Transport

  • Facilitates osmotic water permeability in erythrocytes, kidney proximal tubules, and lung endothelia .

  • Kinetics: Permeability inhibited by mercury ions (Hg²⁺), confirming classical aquaporin behavior .

Pathophysiological Roles

  • Rheumatoid Arthritis (RA): Overexpression in synovial fibroblasts promotes proliferation, migration, and invasion via β-catenin signaling .

  • Neuroregeneration: Enhances axonal growth in dorsal root ganglion (DRG) neurons; Aqp1-knockout mice show impaired nerve regeneration .

Signaling Pathways

PathwayEffect of Aqp1 ModulationModel SystemSource
β-CateninAqp1 siRNA reduces FLS proliferation/migrationRat CIA model
GSK-3β InhibitionLithium chloride reverses Aqp1 siRNA effectsIn vitro FLS

Therapeutic Development

  • Gene Therapy: Adenovirus-mediated Aqp1 delivery restored salivary secretion in irradiated rats (2–3× increased flow rates) .

  • Disease Modeling: Used to study RA synovitis and neuropathic pain mechanisms .

Tool Reagents

  • Antibodies: Anti-Aqp1 antibodies (e.g., Boster Bio PB9473) enable detection in IHC, WB, and flow cytometry .

  • Knockdown Tools: siRNA/shRNA constructs reduce Aqp1 expression by >80% in rat pleural mesothelial cells .

In Vivo Studies

Study FocusKey OutcomeSource
Collagen-Induced ArthritisAqp1 correlates with synovial β-catenin and joint damage
Sciatic Nerve InjuryAqp1 deficiency delays axonal regeneration

In Vitro Studies

Model SystemFindingSource
DRG NeuronsAqp1 transfection rescues axonal growth
Salivary Gland CellsAqp1 increases transepithelial water flux 4×

Future Directions

  • Therapeutic Targeting: Small-molecule inhibitors of Aqp1 could mitigate RA progression .

  • Biomaterial Integration: Aqp1-embedded membranes for artificial kidneys or desalination filters .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Aqp1; Chip28; Aquaporin-1; AQP-1; Aquaporin-CHIP; Water channel protein for red blood cells and kidney proximal tubule
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Aqp1
Target Protein Sequence
MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLENSLGRNDLARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK
Uniprot No.

Target Background

Function
Aquaporin-1 (AQP1) forms a water-specific channel. This channel provides the plasma membranes of red blood cells and kidney proximal tubules with high permeability to water, allowing water to move along an osmotic gradient.
Gene References Into Functions
  1. The decrease in AQP1 protein levels in the endothelium and AQP5 in gland ductal cells of irradiated animals may have hindered water removal from the lumen of ductal cells, leading to a delay in water absorption and a slight lumen increase. PMID: 30060820
  2. Hydrogen-rich solution has been shown to attenuate cardiopulmonary bypass-induced myocardial injury, suppress AQP1 and AQP4 expression following CPB treatment, and protect myocardial cells via the PI3K/Akt signaling pathway. PMID: 29956781
  3. AZ, as an AQP1 inhibitor, exhibits a powerful therapeutic effect on rat AIA by inhibiting NF-kappaB activation, suggesting that AQP1 inhibition might hold potential clinical interest in RA treatment. PMID: 29303021
  4. Both AQP1 mRNA and protein levels were elevated in the choroid plexus of obese rats compared to lean rats. PMID: 28344346
  5. Liquid water metabolic abnormalities and intestinal permeability might be the mechanism of IBS by regulating AQP1, AQP3, and AQP8 via the NF-kappaB pathway. PMID: 28525373
  6. The expression of AQP1 and AQP5 was determined by Western immunoblotting. PMID: 27424549
  7. Elevated AQP1 levels upregulate beta-catenin protein levels, via a mechanism requiring the AQP1 COOH-terminal tail, enhancing the expression of beta-catenin targets. PMID: 28798257
  8. The aortic endothelia of two high-renin hypertensive rat models express greater than two times the aquaporin-1 and, at low pressures, have greater than two times the endothelial hydraulic conductivity of normotensive rats. PMID: 28733452
  9. Lipopolysaccharide significantly impaired lung function and downregulated the expression of AQP1 and AQP5 in the rat lung, all of which were attenuated by hydrogen-rich saline treatment. PMID: 27229103
  10. Aquaporin-1 upregulation/aquaporin-4 downregulation induced under subtoxic 3-nitropropionic acid treatment may play a pivotal role in water homeostasis and cell viability in the striatum. PMID: 27181510
  11. The findings of our study suggest that AQP1 promotes caspase3 activation, contributing to chondrocyte apoptosis and the development of osteoarthritis. PMID: 27779640
  12. Increased AQP1 S-nitrosylation in the youngest group may decrease osmotic water permeability of cardiac membranes, negatively impacting cardiac water balance. PMID: 27261598
  13. COX-2 inhibition may modulate pulmonary AQP-1 expression and attenuate lung injury. PMID: 26724476
  14. AQP1 enhances pulmonary arterial smooth muscle cell migration via the p38-MAPK pathway in rats with Hepatopulmonary syndrome. PMID: 26315345
  15. HBO also upregulated AQP1 and AQP5 expression. PMID: 26317897
  16. Study of AQP1 expression and localization in the rat sciatic nerve; AQP2, AQP4, and AQP9 were not expressed. PMID: 25451277
  17. The expression of AQP-1 decreased in silicotic rats, suggesting that AQP-1 may play a significant role in the formation of silicosis. PMID: 26554235
  18. Reciprocity in the developmental regulation of aquaporins 1, 3, and 5 during pregnancy and lactation. PMID: 25184686
  19. Brain ischemia/reperfusion injury provokes brain edema by alterations of aquaporin-1 and aquaporin-4 expression, and NO is the main signaling factor that modulates gene expression of these channels. PMID: 25441658
  20. Increased expression of AQP 1 and AQP 5 in rat lungs ventilated with low tidal volume is time-dependent. PMID: 25489856
  21. Myocardial AQP1 expression is associated with changes affecting myocardial water homeostasis and function. PMID: 26281310
  22. Results show that the arginine-facing amino acid residue appears to be the most versatile selectivity-determining barrier of the rat AQP1 constriction. PMID: 25341953
  23. Aquaporin-1 significantly contributes to hydrostatic pressure-driven water transport across aortic endothelial monolayers in whole rat aortas. PMID: 25659484
  24. Report male-dominant expression of renal AQP1 in rats. PMID: 25656365
  25. Altered expression of HIF-1alpha, VEGF, and AQP-1 may be involved in the pathological process of lung injury caused by hypoxia. PMID: 25592135
  26. AQP1 protein was expressed in the capillary endothelium, and its level was significantly decreased after irradiation. AQP5 protein was expressed in the alveolar epithelium, and its level was increased between Days 7 and 14 after irradiation. PMID: 24570172
  27. Results show that in AQP1, helix 3 inverts its orientation in the membrane after the initial insertion, whereas this does not occur in the homologous AQP4. PMID: 24777974
  28. Expression in pleural mesothelial cells decreased by staphylococcal peptidoglycan. PMID: 24364558
  29. Aqp1 enhances Bone marrow mesenchymal stem cell migration ability mainly through the focal adhesion kinase pathway and partially through the beta-catenin pathway. PMID: 23962074
  30. Infection increased AQP1 protein levels. PMID: 24328827
  31. Heat acclimation enhanced the expression of AQP5 and AQP1 in rat submandibular glands. PMID: 23942196
  32. The results of the present research suggest that an activation of AQP1, induced by the OA process, may represent an endogenous mechanism that can be used to control tissue degeneration within Osteoarthritis articular joints. PMID: 23164158
  33. AQP1 and AQP5 are increased in small airways in rats with experimentally induced asthma, indicating that they may be involved in the formation of submucosal edema and mucus hypersecretion. PMID: 23199524
  34. Hydrogen peroxide enters vascular smooth muscle cells via aquaporin 1 and activates Nox and ASK1, leading to hypertrophy. PMID: 22997161
  35. AQP1 and AQP5 might play key roles in inflammatory subglottic edema caused by compound 48/80 in rats. PMID: 22921298
  36. Increases in AQP1 and NKCC1 expression under hyposmotic stress may be involved with the molecular mechanisms underlying the pathophysiology of acute hyponatremia. PMID: 22419034
  37. During hypoxic encephaledema, the expression of VEGF, AQP1, and AQP4 mRNA increased. The changes in expression and distribution of these proteins may induce blood-brain barrier injury. PMID: 21560328
  38. Hyalinized tissue and damaged AQP1 positive endothelial cells are phagocytized by macrophages which have temporally migrated. The surviving endothelial cells with intense AQP1 reaction are involved in periodontal regeneration by capillary sprouting. PMID: 22975633
  39. Nervilla fordii pretreatment can promote lung AQP-1 and AQP-5 expression up-regulation, increase lung water clearance and transportation to improve the water balance and eliminate pulmonary edema. PMID: 21038658
  40. Although water deprivation did not significantly change AQP1 levels in the mesenteric arteries, AQP1 protein concentrations were inversely correlated with the ratio of the VACM-1 to Nedd8-modified VACM-1. PMID: 22581383
  41. Shiga toxin 2 induced neuronal alterations and reduced the expression levels of aquaporin 1 and aquaporin 4 in the brain. PMID: 22610042
  42. Hypoxia induces a pulmonary arterial smooth muscle cell -specific increase in [Ca(2+)](i) that results in increased AQP1 protein levels and cell migration. PMID: 22683574
  43. Increased intrarenal Ang II in rats fed with a high-salt diet downregulates renal AQP-1 and AQP-2 expressions. PMID: 22587908
  44. Novel pathway in mammalian cells whereby a hypotonic stimulus directly induces intracellular calcium elevations through transient receptor potential channels, which trigger AQP1 translocation. PMID: 22334691
  45. The up-regulation of AQP-1 expression in osteoarthritic cartilage may be related to chondrocyte apoptosis. PMID: 21500577
  46. AQP-1 and AQP-3 are demonstrated to be associated with lung ischemia-reperfusion in the expression levels. PMID: 22166655
  47. Report age-related changes in expression of renal AQP1 in response to congenital, partial, unilateral ureteral obstruction in rats. PMID: 22028046
  48. Report AQP1 down-regulation in the solitary kidney in response to partial ureteral obstruction in neonatal rats. PMID: 21677414
  49. The severity of myocardial edema after severe burn is correlated to the expression level of AQPl protein. PMID: 20501409
  50. Intestinal AQP-1 expression gradually decreased, and edema worsened in rats early after severe burn. Early enteral feeding can increase the expression. PMID: 20423836

Show More

Hide All

Database Links

KEGG: rno:25240

STRING: 10116.ENSRNOP00000015692

UniGene: Rn.1618

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Erythrocytes and renal tubules.

Q&A

What are the optimal storage and handling conditions for Recombinant Rat Aquaporin-1?

Proper storage and handling of Recombinant Rat Aquaporin-1 is critical for maintaining its stability and functionality. The recommended conditions are:

FormStorage TemperatureShelf LifeNotes
Lyophilized-20°C to -80°C12 monthsPreferred for long-term storage
Liquid-20°C to -80°C6 monthsAliquot to avoid freeze-thaw cycles
Working solution4°CUp to 1 weekFor immediate experimental use

For reconstitution, it is recommended to:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for stability

  • Prepare small aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity

How can functional activity of Recombinant Rat Aquaporin-1 be assessed in research settings?

Multiple experimental approaches can be used to evaluate the functional activity of Recombinant Rat Aquaporin-1:

  • Osmotic Water Permeability Assays: Measure water flux across membranes in response to imposed osmotic gradients. In controlled experiments, cells expressing AQP1 demonstrated approximately five-fold increase in net fluid secretion compared to control cells when exposed to an osmotic gradient (apical 400 mosm; basal 300 mosm) .

  • Biophysical Characterization: The "hourglass model" of AQP1 function can be tested using site-directed mutagenesis combined with functional assays. Researchers have demonstrated the functional independence of AQP1 subunits by expressing mixed tandem dimers with differential mercury sensitivity .

  • Vector-Mediated Expression Systems: Adenoviral vectors encoding AQP1 (such as AdhAQP1) can be used to transduce cells and evaluate subsequent changes in water permeability. This approach has been successfully applied in both in vitro cell models and in vivo animal studies .

  • Fluorescence-Based Water Transport Assays: These can be used to measure the kinetics of cell volume changes in response to osmotic challenges, providing quantitative data on AQP1 functionality.

What expression systems are recommended for producing functional Recombinant Rat Aquaporin-1?

The choice of expression system significantly impacts the yield, purity, and functionality of Recombinant Rat Aquaporin-1:

When evaluating expression systems, researchers should consider:

  • Required protein yield

  • Importance of post-translational modifications

  • Downstream applications (structural studies vs. functional assays)

  • Need for tag incorporation for purification or detection

How is Recombinant Rat Aquaporin-1 being utilized in gene therapy research?

Recombinant Rat Aquaporin-1 has shown promising applications in gene therapy research, particularly for radiation-induced salivary gland damage:

  • Vector Design and Delivery: Research has employed first-generation serotype 5 adenoviral (Ad5) vectors encoding human AQP1 cDNA (AdhAQP1). The vector contains a cytomegalovirus promoter/enhancer to drive expression, with the transgene expression cassette placed in the deleted E1 region via homologous recombination .

  • Dosage Optimization: Clinical testing has involved a dose-escalation approach with the following protocol:

Dosage GroupVector (genomes/gland)Vector (genomes/μl)
14.8 × 10^71 × 10^5
22.9 × 10^85.8 × 10^5
31.3 × 10^92.6 × 10^6
45.8 × 10^91.2 × 10^7
53.5 × 10^100.7 × 10^8
  • Efficacy Assessment: In rodent models receiving 5 × 10^9 plaque-forming units of AdhAQP1 in irradiation-damaged salivary glands, significant restoration of salivary flow was observed compared to controls:

Experimental GroupControl Vector (μl/100g)AdhAQP1 Vector (μl/100g)
Sham-irradiated36.6±6.828.4±8.0
21 Gy irradiated13.2±3.730.6±3.5
  • Safety Evaluation: Comprehensive toxicology studies in rats have shown that administration of AdhAQP1 vector leads to no animal mortality or morbidities, with only minor gender-related effects observed at higher doses .

What is the role of Aquaporin-1 in disease pathogenesis based on experimental models?

Research utilizing recombinant Aqp1 has revealed several important roles in disease processes:

  • Rheumatoid Arthritis (RA): Studies have demonstrated that AQP1 is upregulated in the synovium of RA models and contributes to disease progression. In collagen-induced arthritis (CIA) rat models, synovial AQP1 expression increases in parallel with secondary paw swelling and total pathological score on joint damage .

  • Oncology Applications: AQP1 expression has been linked with tumor malignancy in multiple cancer types. In glioblastoma models, AQP1 accelerates cell migration and invasion by upregulating cathepsin B, focal adhesion kinase, and matrix metalloproteinase 9 activities. It also influences vascular bed formation by downregulating thrombospondin type 1 domain containing 7A (THSD7A) .

  • Hepatic Damage Models: Transgenic mice with endothelial AQP1 overexpression (Tie2-Cre/LNL-AQP1 dTG mice) show exacerbated hepatic damage following heat exposure, with increased inflammation markers and monocyte/macrophage infiltration in liver vessels .

How does Aquaporin-1 influence cellular signaling pathways in experimental models?

Recombinant Aqp1 studies have revealed several key signaling pathways affected by this water channel:

  • Wnt/β-catenin Pathway: AQP1 activates the Wnt/β-catenin signaling pathway in rheumatoid arthritis models. RNA interference experiments show that AQP1 silencing reduces proliferation, migration, and invasion of fibroblast-like synoviocytes (FLS) by inhibiting β-catenin signaling. This effect can be reversed by lithium chloride (an inhibitor of GSK-3β), confirming the mechanistic connection .

  • Cell Cycle and Apoptosis Regulation: AQP1 overexpression promotes cell proliferation by facilitating G0/G1 to S phase transition and inhibiting apoptosis through:

    • Increased mitochondrial membrane potential

    • Elevated Bcl-2 protein levels

    • Decreased levels of Bax and cleaved caspase 3 proteins

  • Migration and Invasion Pathways: AQP1 upregulates cathepsin B and focal adhesion kinase, enhancing matrix metalloproteinase 9 activities that facilitate cell migration and invasion .

These pathways can be experimentally manipulated using:

  • Specific pathway inhibitors (e.g., XAV939 for Wnt/β-catenin)

  • Activators (e.g., LiCl for Wnt/β-catenin)

  • RNA interference techniques targeting AQP1

  • Transgenic models with conditional expression systems

What techniques are most effective for detecting Aquaporin-1 expression and localization in experimental tissues?

Multiple complementary techniques can be employed to accurately detect and quantify Aquaporin-1 expression:

  • Immunohistochemistry (IHC): Provides spatial information about AQP1 distribution in tissues. Typical protocols use:

    • Rabbit polyclonal anti-AQP1 antibodies (1:2000 dilution)

    • Mouse monoclonal antibodies for co-localization studies

    • Diaminobenzidine peroxidase substrate for visualization

    • Mayer's hematoxylin for counterstaining

  • Western Blotting: Quantifies total AQP1 protein levels. Optimized protocols include:

    • Sample preparation with 30 μg protein lysates

    • Resolution by 12.5% SDS-PAGE

    • Transfer to polyvinylidene fluoride membranes

    • Incubation with primary antibodies (typically 1:500-1:2000 dilution)

    • Detection with IRDye-conjugated secondary antibodies

  • Immunofluorescence: Enables precise subcellular localization:

    • Fixed cells are incubated with anti-AQP1 antibodies

    • Fluorophore-conjugated secondary antibodies are applied

    • Confocal microscopy is used for high-resolution imaging

    • Co-staining with organelle markers helps determine exact localization

  • PCR-Based Detection: For gene expression analysis:

    • RNA extraction from tissues/cells

    • cDNA synthesis via reverse transcription

    • Amplification using specific primers for AQP1

    • Example primers: 5′-GAGAATTCTCAGGCCAAGCCCCCTGCCA-3′ and 5′-GAGTCGACACGTGGATGCCCGGGCCAGA-3′

How do human and rat Aquaporin-1 compare, and what are the implications for translational research?

Understanding the similarities and differences between species is crucial for translational applications:

  • Sequence Homology: Human AQP1 (UniProt ID: P29972) and rat AQP1 (UniProt ID: P29975) share high sequence homology, making rat models valuable for studying human diseases .

  • Functional Conservation: Both proteins form water-specific channels with similar permeability characteristics and are expressed in comparable tissues (red blood cells, kidney proximal tubules, choroid plexus) .

  • Translational Considerations: Despite high conservation, species differences should be considered:

    • Human knockout studies have shown surprisingly mild phenotypes, suggesting compensatory mechanisms that may differ between species

    • Expression patterns may vary slightly between tissues

    • Regulatory mechanisms controlling AQP1 expression might differ

  • Antibody Cross-Reactivity: Many commercially available antibodies recognize both human and rat AQP1, facilitating comparative studies. When selecting antibodies, researchers should verify species reactivity - for example, antibody clones like JM10-98 show reactivity to human, mouse, and rat AQP1 .

What are the current challenges and limitations in Aquaporin-1 research methodologies?

Several methodological challenges merit consideration when working with Recombinant Rat Aquaporin-1:

  • Membrane Protein Expression Challenges:

    • Obtaining correctly folded and functional membrane proteins from recombinant systems

    • Achieving high purity (typically >85% by SDS-PAGE) while maintaining functionality

    • Stabilizing the protein during purification and storage

  • Functional Assay Limitations:

    • Water transport measurements can be technically challenging

    • Distinguishing between water transport through AQP1 versus other pathways

    • Controlling for cell membrane properties that might influence measurements

  • In Vivo Models:

    • Gene redundancy and compensatory mechanisms may mask AQP1 functions

    • Human "knockout" mutants for AQP1 have shown no significant clinical effects, suggesting either redundant mechanisms or context-dependent importance

    • Gender-specific responses have been observed in toxicology studies, complicating data interpretation

  • Vector Delivery Systems:

    • Adenoviral vectors can trigger immune responses

    • Achieving tissue-specific delivery remains challenging

    • Optimizing expression levels to achieve therapeutic effects without toxicity

To address these challenges, researchers should:

  • Employ multiple complementary techniques to verify results

  • Include appropriate controls for each experimental system

  • Consider species and gender differences in experimental design

  • Use conditional expression systems to avoid developmental compensation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.