Recombinant Rat Aquaporin-3 (Aqp3)

Shipped with Ice Packs
In Stock

Description

Structure and Biochemical Properties

Recombinant rat AQP3 is a 292-amino acid protein (UniProt ID: P47862) with six transmembrane domains, forming a tetramer structure in the plasma membrane. Key features include:

PropertyDetails
Molecular Weight~31.6 kDa (predicted from sequence)
TagN-terminal His-tag (for purification)
PermeabilityWater, glycerol, urea, ammonia, and hydrogen peroxide
Expression SystemE. coli (most common), yeast, or baculovirus systems

Water and Glycerol Transport

AQP3 mediates bidirectional water and glycerol flux across cell membranes, critical for:

  • Gastrointestinal Fluid Balance: Regulates water absorption in the intestine and colon, with downregulation linked to diarrhea in PEDV infection .

  • Kidney Function: Facilitates water reabsorption in collecting ducts; knockout mice exhibit polyuria and reduced urine osmolality (<275 mOsm vs. >1,200 mOsm in wild-type) .

  • Skin Hydration: Maintains stratum corneum glycerol content, influencing wound healing and skin barrier integrity .

Inflammation and Disease

  • Periodontitis: TNF-α upregulates AQP3 in gingival epithelial cells, enhancing ICAM-1 expression and leukocyte adhesion .

  • Cancer Progression: Overexpression observed in melanoma, lung, and gastrointestinal cancers, potentially promoting tumor growth and metastasis .

Research Applications and Experimental Insights

Recombinant AQP3 is utilized in studies exploring its mechanistic roles:

ApplicationKey Findings
Endosome-to-Cytosol TransferAQP3 transports hydrogen peroxide into endosomes, facilitating lipid peroxidation and antigen release .
Antidiuretic Hormone ResistanceUnlike AQP2, AQP3 is unresponsive to vasopressin, contributing to nephrogenic diabetes insipidus in knockout models .
Viral PathogenesisAQP3 silencing increases PEDV replication in porcine intestinal cells, suggesting antiviral potential .

Critical Research Challenges

  • Tissue-Specific Regulation: Epigenetic modifications (e.g., promoter methylation) alter AQP3 expression in diseases like PEDV infection .

  • Therapeutic Targeting: HDAC inhibitors (e.g., SAHA) upregulate AQP3 in keratinocytes, but clinical relevance remains unclear .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Aqp3; Aquaporin-3; AQP-3; 31.4 kDa water channel protein; Aquaglyceroporin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Aqp3
Target Protein Sequence
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWAFAGNELVVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGQNWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPPPSTEAENVKLAHMKHKEQI
Uniprot No.

Target Background

Function
Aquaporin-3 (AQP3) is a water channel protein crucial for facilitating glycerol permeability and water transport across cell membranes. It serves as a glycerol transporter in skin and plays a significant role in regulating stratum corneum (SC) and epidermal glycerol content. This protein is involved in skin hydration, wound healing, and tumorigenesis. AQP3 provides the kidney medullary collecting duct with high permeability to water, enabling water movement along osmotic gradients. It exhibits slight permeability to urea and might function as a water and urea exit mechanism in antidiuresis within collecting duct cells. AQP3 potentially plays a critical role in gastrointestinal tract water transport and glycerol metabolism.
Gene References Into Functions
  1. Studies have shown a negative relationship between AQP-3 expression and the activity of the p38 MAPK pathway in nucleus pulposus cells under oxidative damage. Overexpression of AQP-3 partially reduces the pathway's activity in nucleus pulposus cells under the same condition. PMID: 30384362
  2. Research findings indicate that mRNA expression of AQP3 varies with age. PMID: 27525904
  3. Elevated expression of AQP3 might confer a more tumor-like phenotype to cells and contributes to the presence of this protein in various tumors. PMID: 26367709
  4. One of the functional mechanisms of intense pulsed light might be related to the regulation of AQP3 protein expression. PMID: 26231231
  5. Evidence suggests that morphine increases the AQP3 expression level in the colon, promoting water absorption from the luminal side to the vascular side and causing constipation. PMID: 25766885
  6. Findings indicate a potential connection between impaired AQP3 expression and delayed reepithelialization in diabetes. Further nursing studies should focus on this mechanism in diabetic wound healing. PMID: 22531364
  7. Expression of aquaporin 3 in the proximal colon of slow transit constipation rat models is down-regulated, impacting water absorption. PMID: 21713710
  8. This study found that AQP3 expression correlated with Helicobacter pylori infection status in gastric cancer tissues. PMID: 23152856
  9. TGF-beta1 induces AQP3, and AQP3 plays a critical role in TGF-beta-induced human peritoneal mesothelial cell migration. PMID: 23041062
  10. Protein expression of AQP3 was significantly lower after ovariectomy and restored to control levels after 17beta-estradiol treatment. This suggests that AQPs might have a role in detrusor overactivity associated with hormonal alterations in female rats. PMID: 21479884
  11. The fecal water content in the colon is regulated by the transport of water from the luminal side to the vascular side, mediated by AQP3. PMID: 22687538
  12. Studies report age-related changes in expression of renal AQP3 in response to congenital, partial, unilateral ureteral obstruction in rats. PMID: 22028046
  13. Studies report AQP3 up-regulation in the solitary kidney in response to partial ureteral obstruction in neonatal rats. PMID: 21677414
  14. AQP-3 expression was exclusively localized to the epididymis. PMID: 15223838
  15. Results suggest that aquaporin 3 is expressed not only in large airways but also in bronchioles and is linked to water movement in pulmonary edema. PMID: 15248066
  16. AQP3 was detected in the alveolar epithelium and duct system. PMID: 15844003
  17. The permeability of immature zebrafish oocytes to water and cryoprotectants was enhanced by exogenous expression of aquaporin-3. PMID: 17325454
  18. Research discusses the role of AQP3 in TNF-alpha-mediated inflammation and the development of periodontitis. PMID: 18543247

Show More

Hide All

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in kidney medulla and papilla, in collecting duct cells. Detected in colon.

Q&A

What is Recombinant Rat Aquaporin-3 and its molecular characteristics?

Recombinant Rat Aquaporin-3 (AQP3) is a laboratory-expressed water channel protein that mirrors the native 292-amino acid water/glycerol-transporting glycoprotein found in rat tissues. The mouse and rat AQP3 sequences share high homology, with the protein functioning as an aquaglyceroporin - a specialized channel that facilitates the transport of both water and small solutes like glycerol across cell membranes. The recombinant protein maintains the structural and functional properties of native AQP3, allowing researchers to investigate its physiological roles in controlled experimental environments. AQP3 belongs to the aquaglyceroporin subgroup that includes AQP7 and AQP9, which are classified separately from water-selective mammalian aquaporins due to their broader solute specificity and distinct sequence homology .

AQP3 is primarily expressed in the basolateral plasma membrane of kidney collecting-duct epithelial cells where it plays a crucial role in water reabsorption and urinary concentration. Beyond the kidney, AQP3 is expressed in multiple tissues including large airways, eye, urinary bladder, skin, and throughout the gastrointestinal tract . This widespread distribution suggests diverse physiological functions beyond simple water transport.

How does rat AQP3 function in water and glycerol transport mechanisms?

Rat AQP3 functions as a relatively weak transporter of water compared to other aquaporins, but serves as an efficient glycerol transporter . Experimental studies using reflection coefficient measurements and mutagenesis approaches have suggested that water and glycerol share a common pathway through the AQP3 protein, although some inhibition experiments have been interpreted to indicate potentially different pathways .

The water permeability function of AQP3 is particularly critical in the kidney collecting duct, where it operates in conjunction with other aquaporins to establish the osmotic gradient necessary for urine concentration. In AQP3 null mice, osmotic water permeability of the cortical collecting-duct basolateral membrane was reduced more than 3-fold compared to wild-type mice, demonstrating its essential role in transepithelial water transport . This finding establishes that basolateral membrane water permeability can become a rate-limiting barrier to water reabsorption when AQP3 is absent or dysfunctional.

What phenotypic changes characterize AQP3 knockout models?

AQP3 null mice generated through targeted gene disruption exhibit specific phenotypic characteristics that illuminate the physiological roles of this aquaporin. The most prominent feature is marked polyuria, with AQP3 knockout mice consuming and excreting approximately 10-fold more fluid than wild-type or heterozygous littermates . This is substantially more severe than the polyuria observed in AQP1-deficient mice (3-fold increase) and contrasts with AQP4 null mice, which do not display polyuria .

The urinary concentrating defect in AQP3 null mice presents as dramatically reduced urine osmolality (approximately 262 milliosmol) compared to wild-type mice (1,270 milliosmol) . When challenged with 1-desamino-8-d-arginine-vasopressin (DDAVP) administration or water deprivation, AQP3 null mice demonstrate a partial ability to concentrate urine, but only to about 30% of the levels achieved by wild-type mice . This distinct pattern of nephrogenic diabetes insipidus differs from that observed in AQP1-deficient mice, where urine osmolality remains in the 600-700 milliosmol range regardless of water deprivation or DDAVP administration .

Importantly, despite the profound effects on urinary concentration, AQP3 null mice demonstrate normal development, perinatal survival, and growth patterns - unlike AQP1 and AQP5 knockout mice, which show significant perinatal mortality and growth retardation .

How does AQP3 deletion affect the expression of other aquaporins?

This AQP2 downregulation follows a pattern similar to that observed in various experimental models of nephrogenic diabetes insipidus, including lithium administration, hypokalemia, hypercalcemia, and ureteral obstruction . The relationship suggests an adaptive response to altered water handling in the kidney collecting ducts, potentially as a protective mechanism against cellular damage from osmotic stress.

The differential impact on aquaporin expression also provides insight into the functional relationships between these proteins in maintaining water homeostasis. The preservation of AQP4 expression may explain the residual concentrating ability observed in AQP3 null mice, as supported by experiments with AQP3/AQP4 double-knockout mice, which demonstrated more severe impairment of urinary-concentrating ability than AQP3 single-knockout mice .

What experimental techniques are optimal for studying recombinant rat AQP3 function?

To effectively study recombinant rat AQP3 function, researchers can employ a comprehensive toolkit of molecular and cellular techniques:

  • Spatial Filtering Optics Method: This technique has been validated for measuring osmotic water permeability of cortical collecting-duct basolateral membranes, providing quantitative assessment of AQP3 function. Studies using this method have demonstrated a >3-fold reduction in water permeability following AQP3 deletion .

  • Gene Silencing Approaches: Small interfering RNA (siRNA) targeting AQP3 can effectively reduce expression by more than 65%, providing a valuable tool for studying AQP3 function in cellular models . This approach enables analysis of AQP3's roles in specific cellular processes without generating knockout animals.

  • Expression Analysis: Quantitative assessment of AQP3 expression requires analysis at both mRNA and protein levels. In studies of inflammatory responses, both transcriptional and translational regulation of AQP3 have been observed following TNF-alpha treatment, requiring comprehensive analysis techniques .

  • Functional Assays: Beyond water permeability measurements, researchers studying AQP3's role in inflammatory processes can utilize adherence assays to measure leukocyte binding to epithelial cells, which has been shown to increase six-fold following TNF-alpha stimulation and can be reduced by 85% through AQP3 silencing .

These methodological approaches can be combined to provide complementary insights into AQP3 function across different experimental contexts.

How does TNF-alpha regulate AQP3 expression and what are the downstream implications?

TNF-alpha strongly increases AQP3 expression at both mRNA and protein levels in epithelial cells through activation of the 55 kDa TNF-alpha receptor (TNFR I) . This regulatory mechanism has been demonstrated in cultured rat primary gingival epithelial cells and the human gingival epithelial cell line Ca9-22, suggesting a conserved pathway across species .

The upregulation of AQP3 in response to TNF-alpha appears to play a critical role in inflammatory processes. Experimental evidence indicates that AQP3 induction contributes to proinflammatory events, including ICAM-1 expression, which facilitates leukocyte adherence to epithelial surfaces . When AQP3 expression is reduced through siRNA-mediated gene silencing, TNF-alpha-induced ICAM-1 expression is significantly attenuated .

The functional significance of this pathway has been demonstrated in adherence assays, where TNF-alpha stimulation results in a six-fold increase in leukocyte adherence to epithelial cells, an effect that can be reduced by 85% following pretreatment with AQP3 siRNA and anti-ICAM-1 antibody . These findings establish AQP3 as an important mediator in the inflammatory cascade, linking TNF-alpha signaling to cellular adhesion processes that contribute to inflammatory pathologies such as periodontitis .

What role does AQP3 play in nephrogenic diabetes insipidus pathophysiology?

The phenotype of AQP3 null mice establishes a distinct form of nephrogenic diabetes insipidus characterized by severe polyuria, urinary hypoosmolality, and partial response to vasopressin analogues . This condition results from impaired water permeability in the basolateral membrane of collecting duct epithelial cells, which becomes rate-limiting for transepithelial water transport in the absence of AQP3 .

The physiological signature of AQP3-deficient nephrogenic diabetes insipidus differs significantly from that observed in AQP1-deficient mice or AQP2-deficient humans . Unlike AQP1 deficiency, where urine osmolality remains in the 600-700 milliosmol range regardless of interventions, AQP3-deficient mice demonstrate some residual concentrating ability, reaching approximately 30% of normal concentrating capacity following vasopressin administration or water deprivation .

The study of AQP3/AQP4 double-knockout mice provides further insight into the compensatory mechanisms at play, as these animals demonstrate greater impairment of urinary-concentrating ability than AQP3 single-knockout mice . This finding suggests that AQP4, another water channel expressed in collecting ducts, partially compensates for AQP3 deficiency.

These observations have important translational implications, suggesting that AQP3 deficiency may account for some cases of nephrogenic diabetes insipidus in humans . Furthermore, the basolateral membrane localization of AQP3 presents a potentially valuable target for drug discovery, as it may be more accessible to blood-borne therapeutic agents than apical membrane proteins .

How does AQP3 contribute to inflammatory processes in epithelial tissues?

AQP3 plays a previously unrecognized role in inflammatory responses in epithelial tissues, particularly in the context of chronic inflammatory conditions such as periodontitis. Immunohistochemical analysis has revealed significantly higher levels of AQP3 expression in inflamed gingival epithelial tissues compared to healthy subjects , suggesting upregulation during inflammatory processes.

The mechanistic relationship between AQP3 and inflammation involves TNF-alpha signaling through TNFR I, leading to increased AQP3 expression which subsequently promotes ICAM-1 expression and leukocyte adhesion . This pathway represents a novel mode of inflammatory regulation at epithelial lesion sites, linking specialized membrane channel function to cellular adhesion mechanisms that facilitate inflammatory cell recruitment.

The functional significance of this relationship has been demonstrated experimentally, where siRNA-mediated silencing of AQP3 significantly attenuates TNF-alpha-induced inflammatory responses, including a dramatic reduction in leukocyte adherence to epithelial cells . These findings suggest that AQP3 may serve as a potential therapeutic target for modulating inflammatory responses in conditions characterized by epithelial inflammation.

What are the promising research avenues for AQP3 as a therapeutic target?

The identification of AQP3 as a key regulator of water homeostasis and an inflammatory mediator opens several promising research avenues:

  • Aquaretic Inhibitor Development: The basolateral membrane localization of AQP3 provides a blood-accessible target for drug discovery, potentially enabling the development of aquaretic inhibitors that could modulate water reabsorption in the kidney . Such agents could have therapeutic applications in conditions characterized by fluid retention.

  • Anti-inflammatory Therapeutics: The role of AQP3 in mediating TNF-alpha-induced inflammatory responses suggests potential for targeted anti-inflammatory approaches . Inhibitors of AQP3 or interventions that modulate its expression could potentially reduce inflammatory cell recruitment and adhesion in conditions such as periodontitis.

  • Gene Therapy Approaches: Understanding the molecular regulation of AQP3 expression could inform gene therapy strategies for addressing AQP3 deficiency or dysregulation. The partial response to vasopressin in AQP3-deficient models suggests that enhancing residual water reabsorption pathways might be a viable therapeutic approach .

  • Biomarker Development: The differential expression of AQP3 in inflammatory conditions suggests potential utility as a diagnostic or prognostic biomarker . Further research into expression patterns in various pathological states could yield valuable clinical tools.

What methodological challenges persist in AQP3 research?

Despite significant advances, several methodological challenges remain in AQP3 research:

  • Distinguishing Water and Glycerol Transport: The dual functionality of AQP3 as both a water and glycerol transporter presents challenges in isolating and quantifying these distinct activities. While some studies suggest a common pathway for water and glycerol, others interpret inhibition experiments as indicating separate pathways . Developing more selective experimental tools to distinguish these functions remains important.

  • Tissue-Specific Roles: The broad tissue distribution of AQP3 suggests diverse physiological roles that may vary by location and context . Developing methodologies to study these tissue-specific functions without confounding systemic effects presents an ongoing challenge.

  • Translational Barriers: While mouse models have provided valuable insights, translating these findings to human physiology and pathology requires careful consideration of species differences and validation in human systems. The conservation of TNF-alpha regulation of AQP3 between rat and human cells provides promising evidence of translational relevance , but broader confirmation is needed.

  • Therapeutic Targeting Specificity: The development of AQP3-targeted therapeutics will require careful consideration of specificity to avoid unintended effects on other aquaporins or in tissues where AQP3 function may be essential. The potential for compensatory mechanisms, as observed with AQP4 in AQP3-deficient mice , adds further complexity to therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.