Recombinant Rat Aquaporin-7 (Aqp7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Aquaporin-7 (Aqp7)

Recombinant Rat Aquaporin-7 (Aqp7) is a genetically engineered protein produced through heterologous expression systems, primarily used to study the functional and structural properties of this aquaglyceroporin. Aqp7 belongs to the aquaporin family and facilitates the transport of glycerol, urea, water, and other small neutral solutes across cellular membranes . In rodents, Aqp7 is critical for glycerol metabolism in adipose tissue, influencing triglyceride synthesis and plasma glucose regulation . Recombinant rat Aqp7 is particularly valued for its role in adipocyte biology and metabolic disease research.

Production Methods

Recombinant rat Aqp7 is typically produced in E. coli or yeast systems, with His-tagged purification for easy detection and immobilization . Key production parameters include:

ParameterValueSource
Host OrganismE. coli or Yeast
TagHis-tag
Purity>90%
Protein Length269 amino acids
Storage BufferPBS pH 7.4, 50% glycerol

For comparison, human Aqp7 recombinant proteins are often expressed in HEK293T cells with C-Myc/DDK tags and exhibit a predicted molecular weight of 37.1 kDa .

Primary Functions

Aqp7 serves as a bidirectional channel for glycerol and water, with critical roles in:

  1. Glycerol Metabolism: Facilitates glycerol efflux from adipocytes, preventing intracellular accumulation and promoting triglyceride synthesis .

  2. Adipocyte Volume Regulation: Modulates water permeability, influencing cell osmotic balance and lipid storage .

  3. Energy Homeostasis: Links adipose-derived glycerol to hepatic gluconeogenesis, impacting fasting blood glucose levels .

pH-Dependent Regulation

Aqp7 permeability is dynamically regulated by extracellular pH. At acidic conditions (pH <6), protonation of residues Tyr135 and His165 reduces glycerol binding affinity, effectively closing the channel . This mechanism is crucial in environments like inflamed tissues or ischemic conditions.

Biophysical Properties

ParameterValue (Human Aqp7)Value (Rat Aqp7)Source
Water Permeability (Pf)~4.38 × 10⁻⁴ cm/sN/A
Glycerol Permeability (Pgly)~13.1 × 10⁻⁶ cm/sN/A
Activation Energy (Ea)9.16 kcal/mol (water)N/A

Note: Rat-specific permeability data remain limited, but functional homology is inferred from human studies .

Functional Implications

  1. Triglyceride Content: Aqp7 knockdown in 3T3-L1 adipocytes correlates with elevated triglyceride levels, confirming its role in lipid metabolism .

  2. Insulin Sensitivity: Aqp7 overexpression enhances glucose uptake and insulin secretion in pancreatic β-cells, suggesting a link to metabolic syndrome .

  3. Immune Responses: Aqp7 modulates dendritic cell migration and antigen presentation, implicating its role in immune regulation .

Applications in Research and Disease Modeling

Recombinant rat Aqp7 is employed in:

  1. Adipocyte Culture Studies: Assessing glycerol flux and lipid droplet dynamics in obesity models .

  2. Membrane Protein Crystallization: Structural studies to elucidate pH-dependent gating mechanisms .

  3. Therapeutic Targeting: Screening inhibitors or modulators for aquaglyceroporin-related disorders (e.g., obesity, diabetes) .

Challenges and Future Directions

  • Species-Specific Variations: Rat Aqp7 may exhibit distinct regulatory properties compared to human isoforms, necessitating comparative studies .

  • Post-Translational Modifications: Limited data exist on phosphorylation or glycosylation effects on rat Aqp7 function .

  • Disease Relevance: Exploring Aqp7’s role in metabolic disorders like non-alcoholic fatty liver disease (NAFLD) and insulin resistance .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate special requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Aqp7; Aquaporin-7; AQP-7; Aquaglyceroporin-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAGSVLENIQSVLQKTWVREFLAEFLSTYVLMVFGLGSVAHMVLGERLGSYLGVNLGFGFGVTMGIHVAGGISGAHMNAAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHYAGGELLVTGPKSTANIFATYLPEHMTLWRGFVDEVFVTGMLQLCIFAITDKLNSPALQGTEPLMIGILVCVLGVSLGMNTGYAINPSRDLPPRFFTFIAGWGKKVFSAGNNWWWVPVVAPLLGAYLGGIVYLGLIHAGIPPQGS
Uniprot No.

Target Background

Function
Aquaporin-7 (AQP7) forms a channel that facilitates water and glycerol transport across cell membranes at neutral pH. The channel is also permeable to urea. AQP7 plays a crucial role in body energy homeostasis, particularly under conditions promoting lipid catabolism, which results in the production of glycerol and free fatty acids. It mediates glycerol export from adipocytes. Upon release into the bloodstream, glycerol is utilized for gluconeogenesis in the liver, helping to maintain normal blood glucose levels and prevent fasting hypoglycemia. AQP7 is also essential for normal glycerol reabsorption in the kidney.
Gene References Into Functions
  1. AQP7 in visceral adipose tissue may contribute to glucose and lipid metabolism related to diabetes and obesity. PMID: 21321634
  2. Arginine vasopressin down-regulates the expression of AQP7 mRNA in the endolymphatic sac. PMID: 19180911
  3. AQP7 plays a significant role in rat testis development and spermatogenesis. PMID: 11676488
  4. Research indicates the presence of AQP7 in the small and large intestine. Its higher expression at the apical pole of superficial epithelial cells suggests its involvement in rapid fluid movement through the villus epithelium. PMID: 15943587
  5. AQP7 and AQP8 are likely involved in water movement through the apical domain of small intestine epithelial cells. PMID: 18059526
  6. Studies have documented the rapid entry of glycerol and urea in BRIN-BD11 cells, likely mediated by AQP7. PMID: 19585522

Show More

Hide All

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm, cell cortex. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Lipid droplet.
Tissue Specificity
Detected in heart, kidney and testis.

Q&A

What is Aquaporin-7 (Aqp7) and what is its primary function in rat models?

Rat Aquaporin-7 (Aqp7) is a 269 amino acid transmembrane protein belonging to the aquaglyceroporin family that forms tetrameric channels in cell membranes . Unlike classical aquaporins that transport only water, Aqp7 facilitates the movement of both water and small neutral solutes, particularly glycerol, across cellular membranes along osmotic gradients . In rat models, Aqp7 plays a crucial role in fluid transport and homeostasis during testis development and spermatogenesis, indicating its importance in reproductive physiology .

The protein contains multiple transmembrane domains that create a selective pore allowing precise control over which molecules can pass through the membrane. Functionally, rat Aqp7 participates in several metabolic pathways including the PPAR signaling pathway and transmembrane transport of small molecules, highlighting its metabolic significance . Gene expression studies have demonstrated that Aqp7 is particularly abundant in adipose tissue, testis, and kidney in rat models, with its expression patterns varying during different developmental stages.

Beyond its reproductive functions, rat Aqp7 contributes significantly to energy homeostasis by facilitating glycerol efflux from adipocytes following triglyceride hydrolysis, making this energy substrate available to other tissues . This mechanism is particularly important during fasting states when adipose tissue lipolysis increases to provide energy substrates for the body.

How does the structure of recombinant rat Aqp7 compare to human AQP7?

Rat Aqp7 and human AQP7 share considerable sequence homology and structural similarity, both functioning as tetrameric transmembrane channels with each monomer independently mediating glycerol and water transport . While rat Aqp7 consists of 269 amino acids, human AQP7 is slightly larger with 342 amino acids, suggesting potential functional or regulatory differences between species . The core structural elements necessary for aquaglyceroporin function are conserved between both species, including the NPA (asparagine-proline-alanine) motifs that are critical for water and glycerol selectivity.

Key differences between rat and human AQP7 appear in specific amino acid residues that affect inhibitor binding and channel function. For example, where human AQP7 contains an asparagine at position 101 (Asn101), related aquaporins like human AQP3 and AQP9 contain methionine residues at equivalent positions (Met90 and Met91, respectively) . These amino acid differences significantly affect how inhibitors interact with the channel, potentially creating species-specific responses to pharmacological agents.

Structural analysis through techniques like X-ray crystallography and cryo-electron microscopy has revealed that both rat and human AQP7 contain upper and lower motifs that interact with channel inhibitors, though the precise configuration of these interaction sites may differ between species . These structural variations must be carefully considered when translating research findings from rat models to human applications, particularly in drug development studies targeting AQP7.

What techniques are most effective for studying the transport properties of recombinant rat Aqp7?

When investigating transport properties of recombinant rat Aqp7, researchers typically employ a combination of reconstitution systems and functional assays. Proteoliposome-based transport assays represent a gold standard approach, where purified recombinant Aqp7 is incorporated into artificial lipid vesicles to measure water and glycerol permeability under controlled conditions. For water transport measurements, stopped-flow light scattering techniques can quantify the rate of liposome shrinkage in response to osmotic gradients, while for glycerol transport, radiolabeled glycerol uptake assays provide precise quantification of transport rates.

Xenopus oocyte expression systems offer another powerful approach, where rat Aqp7 cRNA is injected into oocytes, followed by swelling assays to measure water permeability or direct measurement of radiolabeled glycerol uptake. This system allows for relatively rapid functional assessment and can accommodate mutational studies to examine structure-function relationships. Cell-based assays using mammalian cell lines transfected with rat Aqp7 constructs provide a more physiologically relevant context, though with potentially more complex interpretation due to endogenous transporters.

Advanced biophysical techniques including atomic force microscopy can measure the physical properties of Aqp7 channels, while fluorescence-based assays utilizing pH-sensitive or calcein fluorescence can provide real-time monitoring of transport activity. For inhibitor studies, molecular dynamics simulations, as conducted with human aquaporins, can predict binding sites and conformational changes that affect channel function . These simulations typically require high-performance computing resources and specialized expertise but offer valuable insights into the molecular mechanisms of transport and inhibition.

How does Aqp7 contribute to energy homeostasis in rats?

Rat Aqp7 plays a critical role in energy homeostasis primarily through its function in glycerol metabolism. As a glycerol channel expressed in adipose tissue, Aqp7 mediates the efflux of glycerol formed during triglyceride hydrolysis (lipolysis), preventing excessive accumulation within adipocytes and ensuring this valuable energy substrate becomes available to other tissues, particularly the liver . During fasting or high energy demand states, this glycerol efflux becomes especially important as adipose tissue lipolysis increases to provide energy substrates for the body.

Research in pancreatic beta cells has shown that Aqp7 also regulates intracellular glycerol levels, which may influence insulin secretion mechanisms and glucose sensing . This multifaceted involvement across different metabolic tissues positions Aqp7 as a key regulator in energy metabolism pathways. Interestingly, Aqp7 is also linked to the PPAR signaling pathway, suggesting its involvement in adipocyte differentiation and lipid metabolism regulation at a transcriptional level .

What expression systems are most effective for producing functional recombinant rat Aqp7?

The selection of an appropriate expression system for recombinant rat Aqp7 significantly impacts protein yield, functionality, and subsequent experimental applications. Bacterial expression systems, particularly E. coli, offer advantages for large-scale production of rat Aqp7, as evidenced by commercial recombinant preparations . These systems can be engineered with affinity tags (commonly His-tags) to facilitate purification, though membrane proteins like Aqp7 often require specialized strains and solubilization strategies to achieve proper folding and membrane insertion.

Yeast expression systems, including Pichia pastoris and Saccharomyces cerevisiae, represent alternative platforms for Aqp7 expression that may better accommodate eukaryotic post-translational modifications while maintaining high yield capabilities . These systems typically provide a more native-like membrane environment than bacterial systems, potentially enhancing proper folding and functionality of the expressed protein. Wheat germ cell-free expression systems have been successfully employed for human AQP7 production, suggesting this approach may be adaptable for rat Aqp7 when high purity and proper folding are critical experimental requirements .

For studies requiring mammalian post-translational modifications or trafficking, mammalian cell expression systems such as HEK293 or CHO cells offer advantages despite typically lower yields compared to microbial systems. These expression platforms better recapitulate the native cellular environment, potentially preserving physiologically relevant structural features that might be lost in simpler expression systems. Baculovirus-insect cell systems provide an intermediate option, combining relatively high expression levels with eukaryotic processing capabilities.

Each expression system presents distinct advantages and limitations that should be evaluated based on specific research objectives. For functional studies of rat Aqp7, the wheat germ expression system has demonstrated success with human AQP7 in producing protein suitable for ELISA and Western blot applications, suggesting it may be equally effective for the rat ortholog . Commercial providers typically utilize either E. coli or yeast expression systems with purification to >90% purity, indicating these platforms can yield research-grade recombinant rat Aqp7 .

What purification strategies yield the highest purity and activity for recombinant rat Aqp7?

Effective purification of recombinant rat Aqp7 requires specialized approaches that preserve its structural integrity and functionality while achieving high purity. Affinity chromatography, particularly utilizing nickel-NTA resins for His-tagged Aqp7, provides an efficient initial capture step that can achieve substantial enrichment . This approach benefits from gentle elution conditions using imidazole gradients rather than harsh pH changes that might denature the protein. Following affinity purification, size exclusion chromatography effectively separates the tetrameric Aqp7 from monomers, aggregates, and other contaminating proteins based on molecular size.

Detergent selection represents a critical consideration throughout the purification process since inappropriate detergents can disrupt the quaternary structure or denature the protein. Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) often provide a good balance between efficient membrane protein solubilization and preservation of structure and function. During storage, incorporating 50% glycerol in PBS buffer (pH 7.4) helps maintain protein stability, as implemented in commercial preparations of recombinant Aqp7 .

Quality control assessments are essential at multiple purification stages, with SDS-PAGE and Western blotting confirming identity and purity, while dynamic light scattering can evaluate protein homogeneity and detect unwanted aggregation. For functional validation, reconstitution of purified Aqp7 into proteoliposomes followed by water and glycerol transport assays provides critical confirmation that purification has yielded functionally active protein. Advanced techniques like circular dichroism spectroscopy can verify proper secondary structure content, particularly important when comparing different purification strategies.

Purified recombinant rat Aqp7 may occasionally become entrapped in the seal of product vials during shipment and storage, necessitating brief centrifugation to dislodge any liquid in the container's cap before use . For extended storage, maintaining purified protein at either -20°C or -80°C helps preserve structural integrity and functional activity, though repeated freeze-thaw cycles should be avoided to prevent degradation .

How can researchers validate the functionality of purified recombinant rat Aqp7?

Validating the functionality of purified recombinant rat Aqp7 requires a multi-faceted approach that confirms both structural integrity and transport capabilities. Structural validation typically begins with SDS-PAGE analysis under both reducing and non-reducing conditions to verify molecular weight and assess oligomeric state, followed by Western blotting with specific anti-Aqp7 antibodies to confirm identity. Circular dichroism spectroscopy provides further structural characterization by evaluating secondary structure content, which should align with the expected profile for properly folded aquaporins.

Functional validation through transport assays represents the gold standard for confirming Aqp7 activity. Reconstitution of purified Aqp7 into proteoliposomes allows for stopped-flow light scattering measurements of water permeability, where rapid vesicle shrinkage in response to osmotic gradients indicates functional water channels. For glycerol transport assessment, researchers can measure the uptake of radiolabeled glycerol into Aqp7-containing proteoliposomes or monitor vesicle swelling in response to glycerol gradients using light scattering techniques.

Inhibitor sensitivity tests provide additional functional validation, as properly folded Aqp7 should demonstrate characteristic responses to known aquaporin inhibitors. Based on structural studies of human aquaporins, inhibitor binding involves specific interactions with both upper and lower motifs in the channel, and confirmation of these interactions through binding assays can validate structural integrity . Surface plasmon resonance or microscale thermophoresis techniques can quantify binding affinities between purified Aqp7 and known ligands or inhibitors.

Advanced cryo-electron microscopy techniques, as applied to human aquaporins, can provide definitive structural validation by resolving the three-dimensional conformation of purified rat Aqp7 . This approach confirms proper folding and assembly of the tetrameric complex while potentially revealing important details about the channel structure that influence function. When combined with molecular dynamics simulations, structural data from cryo-EM can also predict functional characteristics that can be experimentally verified through transport assays.

What are the challenges in maintaining the native conformation of Aqp7 during purification?

Preserving the native conformation of rat Aqp7 during purification presents several challenges inherent to membrane protein biochemistry. The amphipathic nature of Aqp7 requires careful selection of detergents that can effectively solubilize the protein from membranes while maintaining the integrity of its transmembrane domains and quaternary structure. Inappropriate detergent selection may disrupt the tetrameric assembly, which is essential for proper channel function, or denature the protein altogether, resulting in non-functional aggregates.

Temperature sensitivity represents another significant challenge, as membrane proteins like Aqp7 often exhibit conformational instability at room temperature during extended purification procedures. Implementing a continuous cold chain workflow, performing purification steps at 4°C, and minimizing the duration of individual purification steps can help preserve native structure. Nevertheless, even with these precautions, some degree of conformational heterogeneity may occur, necessitating careful quality control throughout the purification process.

The presence of multiple cysteine residues in Aqp7 introduces the risk of inappropriate disulfide bond formation during purification, which can distort the native conformation. Including reducing agents such as dithiothreitol (DTT) or β-mercaptoethanol in purification buffers helps maintain cysteines in their reduced state, though these additives must be carefully balanced with other purification requirements. For long-term storage, commercial preparations typically utilize a PBS buffer at pH 7.4 with 50% glycerol, which helps maintain protein stability while preventing freeze-thaw damage .

Proteolytic degradation presents an ongoing challenge during Aqp7 purification, particularly when expressed in eukaryotic systems with active proteases. Incorporating protease inhibitor cocktails throughout the purification process helps mitigate this risk, though extended purification times still increase the likelihood of degradation. Finally, maintaining the delicate balance between protein concentration and aggregation propensity requires careful optimization of buffer conditions, as highly concentrated Aqp7 preparations may exhibit increased aggregation tendencies that compromise both structural integrity and functional properties.

What are the established methods for measuring Aqp7 channel activity in vitro?

Measuring rat Aqp7 channel activity in vitro requires specialized techniques that can quantify both water and glycerol transport across membranes. Proteoliposome-based transport assays represent the most direct approach, where purified recombinant Aqp7 is reconstituted into artificial lipid vesicles at controlled protein-to-lipid ratios. Water permeability is typically measured using stopped-flow light scattering techniques, where proteoliposomes are rapidly mixed with hypertonic solutions, causing water efflux and liposome shrinkage that can be monitored as changes in light scattering intensity over millisecond timescales.

For glycerol transport measurements, researchers can employ radiolabeled glycerol uptake assays, where the influx of [14C] or [3H]-labeled glycerol into Aqp7-containing proteoliposomes is measured at defined time points. Alternatively, fluorescence-based assays utilizing calcein-loaded vesicles can monitor glycerol permeability through self-quenching mechanisms. The calculated permeability coefficients from these assays provide quantitative metrics of channel activity that can be compared between different experimental conditions, Aqp7 variants, or in the presence of potential inhibitors.

Cell-based assays offer complementary approaches for measuring Aqp7 activity in more complex biological contexts. Mammalian cells transiently or stably expressing rat Aqp7 can be used to measure radioisotope-labeled glycerol uptake or glycerol-induced cell swelling through volume-sensitive fluorescent dyes. These cellular systems better recapitulate the native membrane environment but may require careful controls to account for endogenous transporters. Xenopus oocyte expression systems provide another platform where water permeability can be quantified through osmotic swelling assays and glycerol transport through direct uptake measurements.

Advanced techniques like patch-clamp fluorometry can simultaneously measure channel activity and conformational changes, providing insights into the relationship between structure and function. Applying these methodologies to study the effects of potential inhibitors has revealed that interactions with both upper and lower motifs in the channel may contribute to altered affinities, with increased affinity observed when both interactions are engaged (as in human AQP7) and decreased affinity when only interactions with the upper motif occur (as in human AQP3 and AQP9) .

How can researchers distinguish between water and glycerol transport through rat Aqp7?

Distinguishing between water and glycerol transport through rat Aqp7 requires experimental designs that can selectively measure each transport function independently. Differential inhibition studies represent one approach, utilizing compounds that preferentially block either water or glycerol permeation. For example, mercury compounds like HgCl₂ typically inhibit water transport through aquaporins by binding to cysteine residues near the channel pore, while having variable effects on glycerol transport depending on the specific aquaporin isoform.

Temperature coefficient (Q₁₀) analysis provides another method for differentiation, as water diffusion through lipid bilayers exhibits a higher temperature dependence (Q₁₀ ≈ 2-3) compared to channel-mediated water transport (Q₁₀ ≈ 1.2-1.4). By measuring transport rates at different temperatures (typically 10°C and 20°C), researchers can calculate Q₁₀ values that help distinguish between channel-mediated transport and passive diffusion across membranes. This approach works particularly well for water transport measurements but has limitations for glycerol transport assessment.

Size selectivity experiments using molecules of increasing size and comparable hydrophilicity can help map the selectivity profile of Aqp7 channels. By measuring permeability rates for a series of polyols (e.g., glycerol, erythritol, xylitol, mannitol) and plotting permeability against molecular size, researchers can generate a selectivity profile that distinguishes between the relatively non-selective water transport and the more size-restricted glycerol transport. This approach has revealed that aquaglyceroporins like Aqp7 can transport both water and glycerol efficiently through independent pathways within the same tetrameric complex.

Molecular dynamics simulations, as applied to human aquaporins, can provide atomic-level insights into transport mechanisms by predicting the energy barriers and preferred pathways for water versus glycerol molecules through the channel . These computational approaches can guide the design of experimental mutations that selectively impact either water or glycerol transport, allowing researchers to dissect the relative contributions of each transport function to physiological processes. When combined with functional assays using these mutants, researchers can definitively distinguish between the water and glycerol transport capabilities of rat Aqp7.

What fluorescence-based assays are suitable for studying rat Aqp7 function?

Fluorescence-based assays offer powerful approaches for studying rat Aqp7 function due to their high sensitivity, real-time measurement capabilities, and compatibility with high-throughput screening platforms. Calcein-based assays represent one widely used technique, where proteoliposomes or cells are loaded with self-quenching concentrations of calcein. When exposed to glycerol gradients, Aqp7-mediated glycerol influx causes water to follow osmotically, resulting in vesicle or cell swelling that reduces calcein concentration and increases fluorescence intensity, providing a real-time readout of channel activity.

pH-sensitive fluorescent proteins like pHluorin can be utilized to monitor water transport activity indirectly through pH changes that accompany water flux across membranes. By co-reconstituting Aqp7 with a pH-sensitive fluorophore in proteoliposomes and creating a pH gradient, researchers can correlate water flux with fluorescence changes, providing a sensitive measure of water channel activity. These pH-dependent methods require careful buffer design and pH control but offer excellent temporal resolution for kinetic studies.

Förster resonance energy transfer (FRET) techniques enable conformational studies of Aqp7 by incorporating fluorescent donor and acceptor pairs at strategic locations within the protein. This approach can detect subtle structural changes in response to ligand binding, pH changes, or interactions with regulatory proteins. FRET-based methods have been particularly valuable for understanding the gating mechanisms of aquaporins and could be applied to investigate potential regulatory mechanisms controlling rat Aqp7 function.

Fluorescent inhibitor binding assays can directly visualize interactions between Aqp7 and fluorescently labeled inhibitors or ligands. This approach allows for direct measurement of binding affinities, association/dissociation kinetics, and competitive binding studies. Similar approaches have been employed for studying inhibitor interactions with human aquaporins, revealing important structural determinants of inhibitor binding that may apply to rat Aqp7 as well . When combined with site-directed mutagenesis, these fluorescence-based binding assays can define specific residues involved in ligand recognition and inhibitor sensitivity.

How can recombinant rat Aqp7 be incorporated into liposome models for transport studies?

Incorporating recombinant rat Aqp7 into liposome models for transport studies requires careful consideration of lipid composition, protein-to-lipid ratios, and reconstitution methodologies to ensure functional channel incorporation. The detergent-mediated reconstitution method represents the most commonly used approach, where purified Aqp7 in detergent solution is mixed with preformed liposomes, followed by controlled detergent removal using adsorbent beads (e.g., Bio-Beads SM-2) or dialysis. This gradual detergent removal promotes the incorporation of Aqp7 into the lipid bilayer while preserving its native tetrameric structure and functional properties.

Lipid composition significantly impacts reconstitution efficiency and Aqp7 functionality in proteoliposomes. Phosphatidylcholine (PC) lipids, particularly 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), provide a suitable basic matrix for aquaporin reconstitution due to their cylindrical molecular shape and fluid phase behavior at physiological temperatures . Incorporating cholesterol at 10-20 mol% can enhance membrane stability and may better mimic the native membrane environment of Aqp7, potentially improving functional incorporation. Some researchers include small amounts of charged lipids like phosphatidylserine to prevent vesicle aggregation during reconstitution procedures.

The protein-to-lipid ratio requires careful optimization to achieve sufficient incorporation for measurable activity while avoiding protein aggregation or excessive membrane disruption. Typical weight ratios range from 1:50 to 1:500 (protein:lipid), with lower ratios generally yielding higher specific activity but lower total channel density. Following reconstitution, freeze-thaw cycles can improve protein distribution across vesicles, though excessive cycles may damage the protein or disrupt vesicle integrity. Size homogenization through extrusion (typically using 100-200 nm polycarbonate filters) produces uniformly sized proteoliposomes that facilitate consistent transport measurements.

Functional validation of Aqp7 incorporation must confirm both successful protein integration and proper orientation in the membrane. Western blot analysis of proteolyzed samples can assess protein incorporation efficiency, while functional transport assays comparing water and glycerol permeability against control liposomes without Aqp7 confirm that the reconstituted channels are active. Cryo-electron microscopy techniques, similar to those applied to human aquaporin studies, can visualize the distribution and orientation of Aqp7 within proteoliposomes, providing structural confirmation of successful reconstitution .

What are the known inhibitors of rat Aqp7 and how do they compare to human AQP7 inhibitors?

While specific inhibitor studies focusing exclusively on rat Aqp7 remain limited in the literature, insights can be drawn from human AQP7 inhibition mechanisms, which likely apply to the rat ortholog due to structural similarities. Small-molecule inhibitors like Z433927330 have been characterized for human aquaporins, revealing binding interactions with both upper and lower motifs in the channel structure . These inhibitors typically exhibit variable affinities across different aquaporin isoforms, with specific amino acid differences determining binding efficiency and inhibitory potency.

Metal-based inhibitors, particularly mercury compounds such as HgCl₂, represent classical aquaporin blockers that typically act by binding to cysteine residues near the channel pore. These compounds often show broad specificity across multiple aquaporin isoforms but may exhibit species-specific potency differences based on the conservation of critical cysteine residues between rat and human orthologs. While useful for research purposes, mercury compounds generally lack the selectivity and safety profile required for therapeutic applications, driving the search for more selective small-molecule inhibitors.

Phloretin, a plant-derived chalcone found in apple tree leaves, demonstrates inhibitory effects on several aquaglyceroporins including AQP7, though with relatively low potency and selectivity. The binding mechanism likely involves interactions with residues lining the outer vestibule of the channel pore, potentially blocking the entry of water and glycerol into the channel. Given the structural similarities between rat and human AQP7, phloretin likely inhibits both orthologs with comparable potency, though direct comparative studies are lacking in the literature.

Advanced molecular dynamics simulations examining inhibitor interactions with human AQP7 have revealed that specific amino acid differences, such as the presence of asparagine (Asn101) in AQP7 versus methionine in AQP3 (Met90) and AQP9 (Met91), significantly influence inhibitor binding modes and affinities . These findings suggest that similar structural determinants likely govern inhibitor interactions with rat Aqp7, though potential species-specific amino acid variations may result in different inhibition profiles. Comparative studies directly examining inhibitor affinities between rat and human AQP7 would provide valuable insights for translational research and drug development targeting this channel.

How do structural differences between rat and human AQP7 affect inhibitor binding and efficacy?

Structural differences between rat and human AQP7, particularly in key amino acid residues lining the channel pore and vestibules, can significantly impact inhibitor binding modes and efficacy. While both orthologs maintain the core aquaglyceroporin structure with six transmembrane helices and two half-helices containing the signature NPA motifs, subtle sequence variations in the pore region and binding sites can alter the electrostatic surface, hydrophobicity patterns, and steric constraints encountered by inhibitor molecules. These differences potentially translate to altered binding affinities, inhibition kinetics, and selectivity profiles for various inhibitor classes.

Research on human aquaporins has identified specific residues that critically influence inhibitor interactions. For example, the presence of asparagine (Asn101) in human AQP7 versus methionine in related aquaporins (AQP3-Met90, AQP9-Met91) significantly affects inhibitor binding dynamics, allowing inhibitors to sample configurations toward the intracellular opening more frequently in AQP7 . Corresponding amino acid differences between rat and human AQP7 at these positions would likely produce similar effects on inhibitor binding modes. Molecular dynamics simulations examining mutant proteins have confirmed the importance of these residues, showing that methionine-to-asparagine substitutions in AQP3 and AQP9 increase inhibitor interactions with the lower NPA motif, while the reverse mutation in AQP7 reduces such interactions .

Additional structural elements that may differ between rat and human AQP7 include the composition and configuration of the selectivity filter (ar/R region), which controls which molecules can access the channel pore. Variations in the amino acids comprising this region could alter the size, shape, and chemical properties of the filter, potentially affecting inhibitor access to binding sites within the channel. The extracellular and intracellular vestibules, which form the entry points for inhibitors approaching from either side of the membrane, may also contain species-specific variations that influence initial inhibitor recognition and binding.

Understanding these structural differences requires detailed comparative analysis through techniques like homology modeling, molecular dynamics simulations, and ideally, experimental structure determination for both rat and human AQP7. Such structural insights would guide the rational design of species-selective inhibitors, an important consideration for preclinical testing where compounds are typically evaluated in rodent models before advancing to human trials. The development of compounds that similarly inhibit both rat and human AQP7 would facilitate more reliable translation of preclinical findings to clinical applications.

What high-throughput screening approaches are effective for identifying novel rat Aqp7 inhibitors?

High-throughput screening (HTS) for novel rat Aqp7 inhibitors requires assay systems that combine physiological relevance with adaptability to automated screening platforms. Cell-based functional assays represent one effective approach, where mammalian cells stably expressing rat Aqp7 are used in glycerol transport assays adapted to 96- or 384-well formats. These assays typically employ fluorescent indicators of cell volume changes or direct measurement of radiolabeled glycerol uptake inhibition, providing a functional readout that reflects the physiological activity of Aqp7 in cellular membranes.

Fluorescence-based liposome assays offer an alternative screening platform with potentially higher throughput capabilities. In these systems, purified recombinant rat Aqp7 is reconstituted into liposomes containing self-quenching concentrations of fluorescent dyes like calcein. When exposed to glycerol gradients, Aqp7-mediated glycerol influx causes water to follow osmotically, resulting in vesicle swelling that reduces calcein concentration and increases fluorescence intensity. Compounds that inhibit Aqp7 prevent this fluorescence change, providing a simple optical readout suitable for automated screening in microplate formats.

Fragment-based screening approaches using biophysical techniques like surface plasmon resonance (SPR) or differential scanning fluorimetry (DSF) can identify smaller chemical entities that bind to purified rat Aqp7, even if they exhibit only weak inhibitory activity. These fragment hits can then serve as starting points for medicinal chemistry optimization to develop more potent and selective inhibitors. This approach has proven particularly valuable for challenging membrane protein targets where traditional HTS may yield limited chemical diversity in identified hits.

Virtual screening methodologies can complement experimental HTS when structural information about rat Aqp7 is available through homology modeling based on human AQP7 or related aquaporin structures. Molecular docking campaigns can screen millions of virtual compounds against the modeled binding sites, prioritizing those with favorable predicted binding energies and interaction patterns for experimental validation. Incorporating insights from molecular dynamics simulations of human aquaporins, such as the importance of interactions with both upper and lower channel motifs, can further refine virtual screening strategies to identify compounds with higher probability of activity against rat Aqp7 .

How can molecular dynamics simulations guide rational design of rat Aqp7 inhibitors?

Molecular dynamics (MD) simulations offer powerful insights for rational design of rat Aqp7 inhibitors by providing atomic-level understanding of protein-inhibitor interactions and conformational dynamics that influence binding and efficacy. Building on structural data from homology models or experimental structures, MD simulations can reveal binding site characteristics, including pocket flexibility, solvent accessibility, and electrostatic properties that may not be apparent from static structures alone. These dynamic features significantly influence inhibitor binding kinetics and thermodynamics, guiding the design of compounds with optimized interaction profiles.

Simulation-based binding site mapping can identify cryptic pockets or transient binding sites that may not be evident in crystal structures but could provide opportunities for inhibitor engagement. Applied to human aquaporins, MD simulations have revealed that inhibitors like Z433927330 sample different conformational spaces when bound to different AQP isoforms, interacting with both upper and lower motifs in AQP7 but primarily with the upper motif in AQP3 and AQP9 . Similar analyses applied to rat Aqp7 could identify unique binding site features that might be exploited for selective inhibitor design.

Free energy calculations derived from MD trajectories, including techniques like MM-GBSA (Molecular Mechanics-Generalized Born Surface Area) or Free Energy Perturbation (FEP), can quantitatively predict binding affinities for proposed inhibitor candidates. These computational approaches allow for virtual screening of inhibitor modifications before synthetic investment, significantly accelerating the optimization process. By analyzing binding energy contributions from individual protein-inhibitor interactions, researchers can identify which structural features contribute most significantly to binding affinity and selectivity.

MD simulations examining the impact of specific mutations have proven particularly valuable for understanding structural determinants of inhibitor binding. In human aquaporins, simulations of mutant proteins showed that substituting methionine to asparagine in AQP3 (Met90Asn) and AQP9 (Met91Asn) resulted in more frequent sampling of inhibitor conformations interacting with the lower motif, similar to what was observed in wild-type AQP7 . Conversely, the Asn101Met mutation in AQP7 reduced these interactions, demonstrating how single amino acid changes can significantly alter inhibitor binding modes . Applying similar approaches to rat Aqp7 would provide specific guidance for inhibitor design targeting this ortholog.

What functional variants of rat Aqp7 have been identified and characterized?

Research on functional variants of rat Aqp7 remains less extensive compared to human AQP7, though several naturally occurring and experimentally induced variants have been characterized. Naturally occurring single nucleotide polymorphisms (SNPs) in the rat Aqp7 gene have been identified through genomic sequencing efforts, particularly in commonly used laboratory rat strains. These variants may affect protein expression, membrane localization, channel function, or regulatory responses, though comprehensive functional characterization of natural variants remains incomplete in the literature.

Experimentally induced mutations have provided valuable insights into structure-function relationships in rat Aqp7. Site-directed mutagenesis of conserved NPA motifs, which form essential structural elements of the water/glycerol pore, typically results in altered substrate selectivity or impaired channel function. Similarly, mutations in the aromatic/arginine (ar/R) constriction region, which serves as a selectivity filter, can modify the size and charge characteristics of the pore, affecting which molecules can pass through the channel. These experimental variants have helped define the molecular determinants of Aqp7's dual functionality as both a water and glycerol channel.

Promoter variants affecting transcriptional regulation of rat Aqp7 have been identified in some studies, potentially influencing tissue-specific expression patterns and responses to physiological stimuli like fasting or hormonal changes. Drawing parallels from human studies, a functional variant in the promoter region of human AQP7 (-953G>A) has been associated with reduced AQP7 expression in adipose tissue, suggesting similar regulatory variants may exist in rat Aqp7 . Such variants could influence metabolic phenotypes by altering glycerol release from adipose tissue or glycerol handling in other Aqp7-expressing tissues.

Knock-in models with specific Aqp7 variants provide powerful tools for investigating the physiological consequences of altered channel function in vivo. These models allow researchers to examine how specific amino acid changes affect metabolic parameters, adipose tissue function, response to fasting, and other physiological processes in which Aqp7 participates. Combined with cellular and molecular studies of the same variants, these animal models help translate structural insights into understanding of physiological function and potential disease mechanisms related to Aqp7 dysfunction.

How do Aqp7 knockout rat models differ in phenotype from wild-type rats?

Metabolically, Aqp7 KO rats typically exhibit altered glycerol homeostasis with increased intracellular glycerol concentrations in adipocytes due to impaired efflux. This glycerol retention leads to enhanced glycerol kinase activity and increased glycerol-3-phosphate levels, providing more substrate for triglyceride synthesis through re-esterification pathways. Consequently, these animals often develop adult-onset obesity with adipocyte hypertrophy and increased whole-body fat mass despite normal or even reduced food intake compared to wild-type controls. The obesity phenotype in Aqp7 KO rats typically manifests more prominently during aging or when animals are challenged with high-fat diets.

Glucose metabolism abnormalities represent another significant phenotypic feature in Aqp7 KO rat models. These animals typically display impaired glucose tolerance and insulin resistance, which may progress to hyperglycemia with advancing age. The underlying mechanisms involve multiple tissues, including reduced hepatic glucose output during fasting due to limited glycerol availability for gluconeogenesis, altered pancreatic β-cell function related to changes in glycerol metabolism, and peripheral insulin resistance associated with adipose tissue dysfunction. These metabolic abnormalities highlight Aqp7's important role in maintaining whole-body energy homeostasis beyond simple water and glycerol transport.

Reproductive phenotypes may also be apparent in Aqp7 KO rats given the channel's expression in reproductive tissues and its role in spermatogenesis . Male knockout rats may exhibit subtle alterations in sperm parameters, potentially including reduced motility or abnormal morphology related to altered fluid homeostasis during sperm development. Female knockout rats may show changes in follicular development or oocyte quality, though reproductive phenotypes generally appear less pronounced than metabolic abnormalities in most Aqp7 knockout models reported in the literature.

What is the relationship between rat Aqp7 expression levels and metabolic disorders?

Rat Aqp7 expression levels demonstrate dynamic regulation under various metabolic conditions, with important implications for understanding and modeling metabolic disorders. During fasting, rat adipose tissue typically shows upregulated Aqp7 expression, facilitating increased glycerol release from adipocytes to support hepatic gluconeogenesis and maintain blood glucose levels. Conversely, refeeding or insulin treatment generally suppresses Aqp7 expression, reducing glycerol efflux and promoting triglyceride retention in adipocytes. These physiological regulatory patterns indicate Aqp7's important role in adapting glycerol metabolism to nutritional status.

Insulin resistance affects Aqp7 expression patterns in rat models, though the relationship appears bidirectional. Insulin normally suppresses Aqp7 expression in adipocytes, but insulin-resistant states may disrupt this regulation, leading to inappropriate Aqp7 expression that fails to adapt properly to nutritional conditions. Simultaneously, altered Aqp7 expression can contribute to insulin resistance by disrupting normal glycerol metabolism in adipose tissue and other metabolic organs, creating a potential vicious cycle that exacerbates metabolic dysfunction. These complex interactions make Aqp7 both a potential contributor to and consequence of insulin resistance in rat models.

How can CRISPR-Cas9 be used to create specific mutations in rat Aqp7 for disease modeling?

CRISPR-Cas9 technology offers unprecedented precision for creating specific mutations in rat Aqp7, enabling advanced disease modeling that can illuminate the molecular basis of AQP7-related disorders. This approach requires careful design of guide RNAs (gRNAs) targeting specific regions of the Aqp7 gene, with gRNA design algorithms optimizing for high on-target efficiency and minimal off-target effects. For modeling disease-relevant mutations, researchers typically design gRNAs that cut near the desired mutation site, providing either a donor template containing the specific mutation for homology-directed repair (HDR) or relying on non-homologous end joining (NHEJ) for knockout generation.

Knock-in models that introduce specific amino acid substitutions require HDR approaches where donor templates containing the desired mutation are co-delivered with the CRISPR-Cas9 system. For example, to investigate how specific residues affect inhibitor binding, researchers might introduce mutations analogous to those studied in human aquaporins, such as replacing asparagine with methionine at positions corresponding to human AQP7's Asn101 . These precise modifications allow for direct assessment of how specific residues influence channel function, inhibitor sensitivity, or protein-protein interactions in vivo, providing mechanistic insights with greater physiological relevance than cell culture studies.

Conditional knockout or knockin models represent an advanced application of CRISPR-Cas9 technology for Aqp7 disease modeling, allowing tissue-specific or temporally controlled gene modification. These models utilize CRISPR-Cas9 in combination with site-specific recombinase systems (e.g., Cre-loxP or Flp-FRT) to control where and when Aqp7 mutations are expressed. This approach is particularly valuable for dissecting the tissue-specific contributions of Aqp7 to complex metabolic phenotypes, such as distinguishing between the roles of adipose, pancreatic, and renal Aqp7 in glycerol homeostasis and metabolic regulation.

The delivery method for CRISPR-Cas9 components significantly influences success rates for rat Aqp7 mutagenesis. Microinjection of CRISPR components into fertilized rat zygotes represents the most direct approach for germline modification, though this requires specialized equipment and expertise. Alternatively, electroporation of zygotes provides a less invasive option with potentially higher throughput. Lentiviral delivery systems can be used for specific somatic cell modifications in adult rats, enabling tissue-specific Aqp7 modification in fully developed animals. Each delivery method presents distinct advantages and limitations that should be evaluated based on the specific research objectives and available resources.

How can cryo-EM be optimized for structural studies of rat Aqp7 complexes?

Cryo-electron microscopy (cryo-EM) offers powerful capabilities for resolving the structure of rat Aqp7 complexes, particularly when optimized to address specific challenges associated with membrane protein analysis. Sample preparation represents a critical first step, with detergent selection significantly impacting structural integrity and image quality. Mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) typically preserve Aqp7's native tetrameric structure while providing sufficient solubilization for cryo-EM grid preparation. Amphipols and nanodiscs offer alternative solubilization approaches that better mimic the native membrane environment and may reveal physiologically relevant conformational states.

Grid preparation techniques must be optimized to achieve uniform ice thickness and particle distribution across the cryo-EM grid. For rat Aqp7, which forms relatively small tetrameric complexes (approximately 120 kDa), strategies to increase contrast become particularly important. These include using holey carbon grids with thin continuous carbon support films, optimizing blotting conditions to achieve ice of minimal thickness, and potentially employing phase plates during imaging to enhance contrast for these relatively small membrane protein complexes. Recent advances in grid preparation, such as graphene oxide or monolayer graphene supports, can further improve particle orientation distribution and image quality.

Data collection and processing workflows for rat Aqp7 can benefit from strategies applied to human aquaporin studies, where high-resolution structures have been successfully determined . Motion correction algorithms reduce beam-induced movement, while contrast transfer function (CTF) estimation optimizes for accurate structural reconstruction. Particle picking using neural networks trained on reference projections from existing aquaporin structures (such as human AQP7) can improve detection of correctly folded complexes in heterogeneous samples . Classification approaches can separate different oligomeric states or conformational variants, ensuring structural homogeneity in the final reconstruction.

Advanced processing techniques applied to human aquaporin datasets, including non-uniform refinement with D4 symmetry and CTF refinement, have achieved resolutions of 3.2 Å for octameric assemblies . Similar approaches could be applied to rat Aqp7, potentially revealing important structural details about the channel pore, inhibitor binding sites, and protein-protein interfaces within the tetrameric complex. At this resolution, individual amino acid side chains become visible, allowing precise mapping of residues involved in substrate selectivity, channel gating, and inhibitor interactions. These structural insights can directly inform structure-based drug design efforts targeting rat Aqp7 for research or potential therapeutic applications.

What are the best approaches for studying the regulation of rat Aqp7 trafficking in adipocytes?

Studying the regulation of rat Aqp7 trafficking in adipocytes requires integrated approaches spanning molecular biology, advanced microscopy, and physiological stimulation. Fluorescent protein tagging represents a fundamental technique, where rat Aqp7 is fused to fluorescent proteins like GFP or mCherry, enabling real-time visualization of trafficking dynamics in live adipocytes. These constructs should be carefully designed with flexible linkers to minimize interference with trafficking signals, and validation through functional assays ensures the tagged protein retains normal transport capabilities. Expression can be achieved through lentiviral transduction of primary rat adipocytes or adipocyte cell lines, providing stable expression while maintaining physiological regulation.

Advanced microscopy techniques, particularly total internal reflection fluorescence (TIRF) microscopy, offer superior visualization of Aqp7 movements near the plasma membrane with exceptional signal-to-noise ratio. This approach can quantify insertion and retrieval rates of Aqp7-containing vesicles at the cell surface in response to various stimuli. Complementary approaches include spinning disk confocal microscopy for rapid 3D imaging of trafficking throughout the cell volume, and super-resolution techniques like STED or PALM/STORM microscopy that can resolve Aqp7 distribution within membrane microdomains below the diffraction limit, potentially revealing organizational patterns important for channel function.

Physiological stimulation experiments allow researchers to understand how metabolic signals regulate Aqp7 trafficking. Protocols typically involve treating adipocytes with hormones like insulin, catecholamines (e.g., isoproterenol, norepinephrine), or glucocorticoids, followed by quantification of Aqp7 translocation between intracellular compartments and the plasma membrane. These experiments can reveal stimulus-specific trafficking routes and kinetics, providing insights into how Aqp7 distribution adapts to changing metabolic demands. Temporal analysis of these responses through time-lapse imaging can further elucidate the sequence of molecular events governing Aqp7 redistribution.

Molecular manipulation of trafficking machinery through overexpression, knockdown, or pharmacological inhibition helps identify specific components required for Aqp7 trafficking. Common targets include Rab GTPases (particularly Rab10 and Rab14, which regulate GLUT4 trafficking in adipocytes), SNARE proteins involved in vesicle fusion, and cytoskeletal components that facilitate vesicle movement. Combining these interventions with live-cell imaging of fluorescently tagged Aqp7 can establish causal relationships between specific trafficking machinery components and Aqp7 membrane localization. These approaches have revealed that aquaporin trafficking often involves complex regulation by phosphorylation events, ubiquitination, and interactions with adaptor proteins that couple the channels to the cellular trafficking machinery.

How do post-translational modifications affect rat Aqp7 function?

Post-translational modifications (PTMs) of rat Aqp7 represent critical regulatory mechanisms that dynamically modulate channel activity, localization, and protein-protein interactions in response to changing physiological conditions. Phosphorylation constitutes one of the most extensively studied PTMs affecting aquaporins, with several potential phosphorylation sites predicted in rat Aqp7 based on consensus sequences for kinases like PKA, PKC, and AMPK. These phosphorylation events typically occur on serine and threonine residues in cytoplasmic domains, particularly the N- and C-terminal tails, where they can alter channel gating, trafficking patterns, or interactions with regulatory proteins and the cytoskeleton.

Ubiquitination plays a crucial role in regulating Aqp7 membrane residence time and degradation pathways. This modification involves the covalent attachment of ubiquitin to lysine residues, potentially marking Aqp7 for internalization from the plasma membrane or targeting to the proteasome or lysosome for degradation. Under basal conditions, constitutive ubiquitination and deubiquitination establish steady-state membrane levels of Aqp7, while changes in ubiquitination rates in response to hormonal signals can rapidly adjust channel density at the cell surface. Studying these dynamics typically involves immunoprecipitation of Aqp7 followed by ubiquitin-specific Western blotting or mass spectrometry to identify modified residues.

Glycosylation represents another important PTM potentially affecting rat Aqp7 function and trafficking. N-linked glycosylation at asparagine residues within the consensus sequence Asn-X-Ser/Thr can influence protein folding in the endoplasmic reticulum, quality control, and trafficking through the secretory pathway. While not all aquaporins are heavily glycosylated, even minimal glycosylation can affect channel stability and cell surface targeting. Experimental approaches for studying Aqp7 glycosylation include enzymatic deglycosylation followed by Western blotting to observe mobility shifts, lectin binding assays, and site-directed mutagenesis of predicted glycosylation sites to evaluate their functional importance.

Advanced mass spectrometry-based proteomics offers comprehensive analysis of rat Aqp7 PTMs under different physiological conditions. This approach typically involves immunoprecipitation of Aqp7 from adipocytes or other expressing tissues, followed by digestion and liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis to identify and quantify specific modifications. Comparing PTM profiles between basal and stimulated conditions (e.g., fasting vs. fed, insulin treatment, adrenergic stimulation) reveals dynamic regulatory patterns that correlate with channel function and localization. Complementary functional studies using phosphomimetic or phosphodeficient mutants, ubiquitination-resistant variants, or glycosylation site mutants can establish causal relationships between specific PTMs and aspects of Aqp7 function or regulation.

What are the latest findings on rat Aqp7's role in glucose homeostasis?

Recent research has expanded our understanding of rat Aqp7's multifaceted role in glucose homeostasis, revealing complex interactions across multiple metabolic tissues. In adipose tissue, Aqp7-mediated glycerol efflux following lipolysis provides substrate for hepatic gluconeogenesis during fasting states, directly contributing to maintaining blood glucose levels. Conversely, insulin-induced suppression of Aqp7 expression reduces glycerol release, limiting gluconeogenic substrate availability when exogenous glucose is abundant. This reciprocal regulation creates a finely tuned system linking adipose tissue lipolysis to hepatic glucose production through Aqp7-dependent glycerol flux.

Emerging evidence suggests direct involvement of rat Aqp7 in pancreatic β-cell function, where it regulates intracellular glycerol levels that may influence insulin secretion mechanisms . Glycerol metabolism in β-cells can affect ATP production, membrane potential, and ultimately insulin granule exocytosis in response to glucose stimulation. Altered Aqp7 expression or function in β-cells could therefore impact glucose-stimulated insulin secretion, potentially contributing to impaired glucose tolerance observed in some Aqp7-deficient models. This pancreatic role represents an additional mechanism through which Aqp7 influences glucose homeostasis beyond its effects on glycerol availability for gluconeogenesis.

The relationship between Aqp7 and insulin sensitivity has garnered increased research attention, with evidence suggesting bidirectional interactions. Insulin resistance often correlates with dysregulated Aqp7 expression in adipose tissue, potentially contributing to altered glycerol metabolism and lipid accumulation. Simultaneously, abnormal Aqp7 function can promote insulin resistance through multiple mechanisms, including excessive hepatic glucose production driven by unregulated glycerol release, lipotoxicity from aberrant lipid storage patterns, and potential direct effects on insulin signaling pathways in target tissues. These interconnected processes create potential feedback loops where initial metabolic disturbances involving Aqp7 can progressively worsen glucose homeostasis.

Advanced transgenic models with tissue-specific Aqp7 manipulation have helped dissect the relative contributions of different organs to Aqp7's effects on glucose homeostasis. These models typically utilize Cre-loxP systems to delete or overexpress Aqp7 selectively in adipose tissue, liver, pancreatic β-cells, or other metabolic tissues. Comparing phenotypes across these tissue-specific models provides insights into which aspects of the glucose homeostasis defects observed in global Aqp7 knockout models arise from specific tissues. Combined with tracer studies measuring glycerol flux between tissues under different nutritional states, these approaches have revealed the integrated nature of Aqp7's role in whole-body energy metabolism, where its coordinated regulation across multiple tissues collectively maintains glucose homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.