Recombinant Rat Aquaporin-8 (Aqp8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Aquaporin-8 (Aqp8)

Recombinant Rat Aquaporin-8 (Aqp8) is a water channel protein that belongs to the aquaporin family, which plays a crucial role in water and small solute transport across cell membranes. Aquaporins are integral membrane proteins found in various tissues and organs, facilitating the movement of water and, in some cases, small molecules like glycerol and urea. Aqp8, specifically, has been studied for its unique permeability properties and its potential roles in physiological processes.

Structure and Function

Aqp8 proteins from rat, human, and mouse have been expressed in yeast, purified, and reconstituted into proteoliposomes for functional studies. These proteins show high sequence similarity but require different detergents for purification due to their distinct biochemical properties . The recombinant rat Aqp8 (rAqp8) has been characterized for its ability to transport water but not glycerol or urea .

Key Features of rAqp8:

  • Water Permeability: rAqp8 facilitates the transport of water across membranes.

  • Inhibitors: Water transport is inhibited by mercuric chloride and can be rescued by 2-mercaptoethanol.

  • Permeability to Small Molecules: Unlike some other aquaporins, rAqp8 does not transport glycerol or urea but is permeable to formamide .

Permeability Studies

SpeciesWater PermeabilityGlycerol PermeabilityUrea PermeabilityFormamide Permeability
RatYesNoNoYes
HumanYesNoNoYes
MouseYesNot specifiedNot specifiedNot specified

Note: The table summarizes the permeability properties of Aqp8 from different species based on available data. The mouse data is less detailed in the literature reviewed.

Physiological Roles

Aqp8 has been implicated in various physiological processes, including maintaining acid-base equilibrium through the transport of ammonium analogues . In the liver, Aqp8 is involved in ammonia detoxification by facilitating the conversion of ammonia to urea . Additionally, Aqp8 plays a role in the gastrointestinal tract, where its expression is enhanced after subtotal colectomy, suggesting a function in intestinal fluid balance .

Expression and Localization

Aqp8 is expressed in several tissues, including the liver, gastrointestinal tract, and salivary glands. In the liver, it is localized to the mitochondria, where it modulates water transport and osmotic swelling . In salivary glands, Aqp8 is found in the apical membranes of epithelial cells, contributing to fluid secretion .

Applications and Future Research Directions

Given its roles in water transport and ammonia metabolism, recombinant rat Aqp8 could be used in studies aimed at understanding and manipulating these processes. For instance, enhancing Aqp8 expression in the liver might improve ammonia detoxification pathways, which could be beneficial in conditions like hepatic encephalopathy . Additionally, its role in hydrogen peroxide transport suggests potential applications in oxidative stress research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Aqp8; Aquaporin-8; AQP-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Aqp8
Target Protein Sequence
MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLFIGDEKTRLILKSR
Uniprot No.

Target Background

Function
Recombinant Rat Aquaporin-8 (AQP8) forms water-specific channels and exhibits mercury sensitivity. It plays a significant role in spermatogenesis, fertilization, and the secretion of pancreatic juice and saliva.
Gene References Into Functions

Functional Studies of Aquaporin-8 (AQP8):

  1. Hepatic mitochondrial AQP8 (mtAQP8) expression is downregulated in acidosis, potentially contributing to reduced ureagenesis from ammonia. PMID: 26194146
  2. Downregulation of hepatocyte mtAQP8 impairs ureagenesis from ammonia in lipopolysaccharide-treated rats. PMID: 24642373
  3. AQP3 and AQP8 may be involved in inflammatory bowel disease pathogenesis. PMID: 24286754
  4. Hepatocyte mtAQP8 channels facilitate mitochondrial ammonia uptake and urea metabolism, particularly under glucagon stimulation. PMID: 23299935
  5. AQP8 in the proximal tubule facilitates mitochondrial ammonia transport in response to acidosis. PMID: 22622463
  6. Dysregulated AQP8 protein and mRNA expression in pregnant rats with intrahepatic cholestasis may contribute to the disease pathogenesis. PMID: 18683753
  7. Increased AQP8 expression in the placental labyrinth is observed in maternal undernutrition. PMID: 20958229
  8. Mitochondrial AQP8 primarily functions in ammonia diffusional transport. PMID: 20132793
  9. AQP8 plays a significant role in rat testis development and spermatogenesis. PMID: 11676488
  10. AQP8 immunolocalization is observed in the kidney and other organs. PMID: 11704555
  11. AQP8's cellular and subcellular distribution suggests roles in intestinal water absorption and bile/pancreatic juice secretion. PMID: 11824790
  12. AQP8 is implicated in canalicular bile secretion in rat hepatocytes. PMID: 11932260
  13. AQP8 is exclusively expressed in Sertoli cells. PMID: 12002438
  14. Defective AQP8 expression contributes to bile secretory dysfunction in cholestatic hepatocytes. PMID: 12717383
  15. Glucagon induces AQP8 translocation to the hepatocyte canalicular membrane, increasing water permeability. PMID: 12774023
  16. AQP8-mediated water transport is important for mitochondrial volume changes during oxidative phosphorylation and apoptosis. PMID: 15749715
  17. AQP8 plays a major role in colonic water movement via apical membrane transport. PMID: 16177191
  18. AQP8 is expressed in myoepithelial cells of the rat submandibular and parotid glands. PMID: 16311720
  19. Defective canalicular AQP8 expression contributes to bile secretory dysfunction in cholestatic hepatocytes. PMID: 17110522
  20. AQP8 primarily functions in electrically silent ammonia transport. PMID: 17189259
  21. Defective hepatocyte AQP8 expression contributes to bile secretory dysfunction in sepsis. PMID: 18662282
  22. Glucagon induces AQP8, but not AQP9, gene expression in rat hepatocytes. PMID: 19193945
Database Links

KEGG: rno:29172

STRING: 10116.ENSRNOP00000019939

UniGene: Rn.6315

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in sperm, pancreas and liver. Some expression has been found in salivary gland and absorptive colonic epithelial cells.

Q&A

What is rat Aquaporin-8 and what are its primary functions?

Aquaporin-8 (AQP8) is a member of the aquaporin family of channel proteins that facilitate the transport of water and certain small solutes across cell membranes. In mammals, 13 aquaporin members (AQP0-AQP12) have been identified, with AQP8 showing wide distribution across many tissues and organs . Rat AQP8 (rAQP8) primarily functions as a water-transporting channel, playing a crucial role in maintaining cellular fluid and electrolyte balance .

Studies utilizing purified recombinant rAQP8 reconstituted into proteoliposomes have demonstrated that it functions primarily as a water channel. Unlike some other aquaporins, rAQP8 shows selective permeability - it does not transport glycerol or urea but is permeable to formamide (an ammonium analogue), suggesting a potential physiological role in ammonium transport . This selective permeability could contribute to acid-base equilibrium in various tissues where rAQP8 is expressed.

How is rat AQP8 typically expressed and purified for research applications?

Recombinant rat AQP8 can be expressed in yeast expression systems for subsequent purification. The standard methodology involves:

  • Cloning the rAQP8 cDNA into an appropriate yeast expression vector

  • Transforming the construct into a suitable yeast strain

  • Inducing protein expression under controlled conditions

  • Cell disruption and membrane fraction isolation

  • Detergent-based solubilization of membrane proteins

  • Purification using affinity chromatography techniques

  • Reconstitution into proteoliposomes for functional characterization

It's important to note that despite high sequence similarity among rat, human, and mouse AQP8, different detergents must be used during purification prior to reconstitution . This species-specific requirement highlights the subtle structural differences that may exist among AQP8 orthologs, which researchers must account for when designing purification protocols.

Where is AQP8 normally expressed in rat tissues?

AQP8 exhibits a wide tissue distribution pattern in rats, with expression detected in multiple organs of the gastrointestinal tract including salivary glands, liver, pancreas, small intestine, and colon . Additionally, AQP8 is expressed in testes, heart, kidney, and airways .

In epithelial cell types, AQP8 often displays polarized distribution. For example, in the rat submandibular epithelial cell line (SMIE), confocal immunofluorescence experiments have revealed that AQP8 protein is primarily localized to the apical membranes of these cells . This polarized distribution suggests a directed role in fluid transport across epithelial barriers.

What methods are commonly used to detect rat AQP8 expression?

Several complementary techniques are routinely employed to detect and quantify rat AQP8 expression:

  • RT-PCR and quantitative real-time PCR: These methods allow for detection and quantification of AQP8 mRNA levels. Specific primers targeting rat AQP8 can be designed (examples from the literature include forward primer: 5'-gcctgaatttggcaatgaca-3' and reverse primer: 5'-aaaccgttcgtaccaggacact-3') .

  • Immunocytochemistry/Immunohistochemistry: These techniques enable visualization of AQP8 protein localization within cells or tissues using specific antibodies against AQP8, followed by detection with secondary antibodies and appropriate visualization systems .

  • Western blotting: This method allows for protein detection and semi-quantitative analysis of AQP8 expression levels in tissue or cell lysates.

  • Functional assays: Water permeability measurements in plasma membranes from tissues expressing AQP8 can provide functional evidence of AQP8 expression and activity .

How do rat, human, and mouse AQP8 proteins differ in their functional properties?

Despite high sequence similarity, rat, human, and mouse AQP8 proteins exhibit both shared and distinct functional properties:

PropertyRat AQP8 (rAQP8)Human AQP8 (hAQP8)Mouse AQP8 (mAQP8)
Water permeabilityYesYesYes
Urea permeabilityNoNoNot fully characterized
Glycerol permeabilityNoNoNot fully characterized
Formamide permeabilityYesYesNot fully characterized
Methylammonium uptakeNot testedYesNot tested
Mercury sensitivityYes (inhibited)Yes (inhibited)Yes (inhibited)
2-Mercaptoethanol rescueYesYesYes
Detergent requirements for purificationSpecies-specificSpecies-specificSpecies-specific

All three AQP8 proteins transport water with high efficiency. Studies with purified and reconstituted proteins have shown that both rAQP8 and hAQP8 are not permeable to urea or glycerol, contradicting some earlier studies using frog oocyte expression systems . Both rat and human AQP8 show permeability to formamide, and hAQP8 has demonstrated permeability to methylammonium, suggesting a potential physiological role in ammonium transport .

These comparative findings highlight the importance of using purified proteins in functional studies to accurately characterize transport properties, as expression system artifacts may occur in cellular models.

What are the functional consequences of AQP8 knockout in animal models?

Studies of AQP8-null mice have provided insights into the physiological roles of AQP8. AQP8-knockout mice, which lack detectable AQP8 transcript and protein, show reduced water permeability in plasma membranes from testes . Surprisingly, despite this functional alteration, AQP8-null mice exhibit largely normal phenotypes in terms of:

  • Survival and growth rates comparable to wild-type mice

  • Normal serum and urine chemistry values

  • Unimpaired urinary concentrating ability (urine osmolality: 3,590 ± 360 mosmol/kgH₂O)

  • Typical weight loss (22 ± 2%) after 36-hour water deprivation

The most notable phenotypic difference observed was increased testicular weight in AQP8-null mice (7.3 ± 0.3 mg/g body weight) compared to wild-type mice (4.8 ± 0.7 mg/g body weight) . This finding suggests a potentially important role for AQP8 in testicular development or fluid homeostasis that warrants further investigation.

The mild phenotype of AQP8-null mice suggests potential functional redundancy with other aquaporins or compensatory mechanisms that maintain water homeostasis in the absence of AQP8.

How can recombinant rat AQP8 be functionally characterized after purification?

Following successful purification, recombinant rat AQP8 can be functionally characterized using several complementary approaches:

  • Proteoliposome reconstitution: Purified rAQP8 can be reconstituted into proteoliposomes to create a system for measuring transport properties. This involves incorporating the purified protein into artificial lipid vesicles under controlled conditions.

  • Stopped-flow measurements: This technique allows for rapid kinetic analysis of water permeability across proteoliposomes. By exposing rAQP8-containing proteoliposomes to osmotic gradients and measuring the rate of volume change (typically through light scattering), researchers can quantify water permeability coefficients.

  • Inhibitor studies: The sensitivity of rAQP8 to inhibitors such as mercuric chloride can be tested, along with the ability of reducing agents like 2-mercaptoethanol to rescue this inhibition . These studies help characterize the pharmacological properties of the channel and identify key functional residues.

  • Substrate specificity assays: Various potential substrates (water, glycerol, urea, formamide, ammonium analogues) can be tested to determine the selectivity profile of rAQP8. For small neutral solutes, direct permeability measurements in proteoliposomes can be performed, while for charged molecules like ammonium, radioactive tracers (e.g., [14C]methylammonium) can be used .

  • Heterologous expression assays: Complementary to in vitro studies, rAQP8 can be expressed in cell systems such as Xenopus oocytes to measure transport functions in a cellular context, though careful interpretation is needed given potential differences between in vitro and cellular results.

What are the effects of osmotic conditions on AQP8 expression and function?

Osmotic regulation of AQP8 expression has been demonstrated in several cell types. In retinal pigment epithelial (RPE) cells, hyperosmotic conditions significantly increase AQP8 expression . This upregulation can be induced by adding either 100 mM NaCl or 200 mM sucrose to the culture medium, indicating that the response is due to osmotic effects rather than specific ion effects .

The mechanism of hyperosmotic AQP8 induction appears to involve several pathways:

  • NFAT5 (Nuclear Factor of Activated T-cells 5) pathway: Knockdown experiments using NFAT5 siRNA have shown that this transcription factor, which responds to osmotic stress, is involved in regulating AQP8 expression under hyperosmotic conditions .

  • ATP-sensitive potassium (KATP) channels: Inhibition of KATP channels reduces hyperosmotic AQP8 gene expression, suggesting a role for these channels in the signaling pathway leading to AQP8 upregulation .

These findings suggest that AQP8 expression is dynamically regulated in response to osmotic challenges, potentially as an adaptive mechanism to maintain cellular volume and homeostasis during osmotic stress. In functional studies with SMIE cells (rat submandibular epithelial cells), exposure to hyperosmotic solutions (440, 540, or 640 mOsm) resulted in 8-25 fold increases in net fluid movement across the cell monolayer compared to isosmotic conditions , demonstrating the functional significance of AQP8 in osmotic adaptation.

What methodological challenges exist in studying recombinant rat AQP8?

Researchers studying recombinant rat AQP8 face several methodological challenges that require careful consideration:

  • Detergent selection for purification: Despite high sequence similarity, AQP8 proteins from rat, human, and mouse require different detergents for effective purification . Identifying the optimal detergent for rat AQP8 purification requires systematic testing.

  • Functional reconstitution: Successful reconstitution of purified rAQP8 into proteoliposomes requires careful optimization of lipid composition, protein-to-lipid ratios, and reconstitution conditions to maintain protein structure and function.

  • Distinguishing water and small solute transport: Because AQP8 can transport both water and certain small solutes like formamide, designing assays that can clearly distinguish between different transport activities requires careful experimental design.

  • Antibody specificity: Ensuring antibody specificity for rat AQP8 is crucial for accurate detection and localization studies. Cross-reactivity with other aquaporins or non-specific binding can lead to erroneous results.

  • Physiological relevance: Bridging the gap between in vitro characterization of purified rAQP8 and its physiological functions in vivo remains challenging, especially given the relatively mild phenotype of AQP8-null mice .

  • Species differences: Extrapolating findings from rat AQP8 to human applications requires careful consideration of species-specific differences in expression, regulation, and function, as highlighted by the differential transport properties observed between species .

How is AQP8 expression altered in disease states, and what are the implications for using rat AQP8 as a disease model?

Studies have shown that AQP8 expression can be altered in various disease states. In inflammatory bowel disease (IBD), specifically ulcerative colitis (UC), AQP8 expression is differentially regulated compared to healthy controls . AQP8 mRNA expression is reduced in the ileum and induced in the colon of patients with UC . The AQP8 gene is located on chromosome 16p12.1, which falls within the IBD locus 8, suggesting a potential genetic link between AQP8 and IBD susceptibility .

For researchers using rat AQP8 in disease modeling, these findings have several implications:

  • Translational relevance: Changes in AQP8 expression in human disease suggest that studying rat AQP8 regulation could provide insights into disease mechanisms and potential therapeutic approaches.

  • Tissue-specific expression: The differential regulation of AQP8 in different segments of the gastrointestinal tract in IBD highlights the importance of studying tissue-specific expression patterns in disease models.

  • Genetic analysis: The location of AQP8 within an IBD susceptibility locus suggests that genetic variants may affect AQP8 function or expression. Researchers working with rat models should consider genetic background and potential strain differences in AQP8 expression and function.

  • Osmotic dysregulation: Given the role of AQP8 in osmotic regulation and fluid transport, altered AQP8 expression in disease states may contribute to pathophysiological changes in fluid homeostasis. This suggests potential applications for rat AQP8 research in understanding disease-related fluid dysregulation.

What are the recommended expression systems for producing recombinant rat AQP8?

Based on successful studies in the literature, the following expression systems are recommended for producing recombinant rat AQP8:

  • Yeast expression systems: Yeast has been successfully used to express recombinant rAQP8, hAQP8, and mAQP8 proteins . Benefits include:

    • Eukaryotic protein processing capabilities

    • High yield of membrane proteins

    • Ability to scale up production

    • Less complex than mammalian systems but more suitable than bacterial systems for membrane proteins

  • Xenopus oocyte expression system: For functional characterization rather than large-scale purification, Xenopus oocytes have been used to express AQP8 and study its transport properties . This system is particularly useful for:

    • Electrophysiological measurements

    • Radiotracer uptake studies (e.g., [14C]methylammonium)

    • Water permeability assays

  • Mammalian cell lines: For studies focusing on regulation, trafficking, or physiological roles, mammalian cell expression systems may be preferable. The SMIE rat submandibular epithelial cell line naturally expresses AQP8 , making it a valuable model for studying endogenous AQP8 regulation and function.

The choice of expression system should be guided by the specific research objectives, with yeast systems generally preferred for purification, Xenopus oocytes for functional characterization, and mammalian systems for physiological studies.

What molecular techniques are most effective for studying rat AQP8 gene expression and regulation?

Several molecular techniques have proven effective for studying rat AQP8 gene expression and regulation:

  • Real-time RT-PCR: This quantitative approach allows precise measurement of AQP8 mRNA levels. Effective primer design is crucial; published primers for rat AQP8 include:

    • Forward: 5'-gcctgaatttggcaatgaca-3'

    • Reverse: 5'-aaaccgttcgtaccaggacact-3'

    • Probe: 5'- cagggagccgagcgtgggtg-3'

  • siRNA knockdown: RNA interference techniques using specific siRNAs targeting AQP8 have been successfully employed to reduce AQP8 expression and study resulting functional changes . For optimal knockdown:

    • Transfection conditions should be optimized for each cell type

    • Knockdown efficiency should be verified at both mRNA and protein levels

    • Appropriate negative controls (non-targeted siRNA) should be included

  • Promoter analysis: To study transcriptional regulation of the AQP8 gene, promoter analysis techniques such as:

    • Luciferase reporter assays with the AQP8 promoter region

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

    • DNA footprinting to identify protein-DNA interactions

  • DNA sequencing: For identification of genetic variants in the AQP8 gene, DNA sequencing of the promoter region and exons can be performed . This approach is valuable for:

    • Identifying polymorphisms that may affect expression or function

    • Developing specific genetic models

    • Correlating genetic variation with phenotypic differences

How can the water transport function of recombinant rat AQP8 be accurately measured?

Accurate measurement of water transport function in recombinant rat AQP8 requires specialized techniques:

  • Stopped-flow light scattering with proteoliposomes: This is the gold standard method for quantitative measurement of water permeability in purified AQP8. The approach involves:

    • Reconstituting purified rAQP8 into proteoliposomes

    • Subjecting these vesicles to rapid mixing with solutions of different osmolarity

    • Measuring the rate of vesicle shrinkage or swelling by light scattering

    • Calculating water permeability coefficients from the rate constants

  • Cell volume change assays: For cellular systems expressing rAQP8, measuring the rate of cell volume change in response to osmotic challenges can provide functional evidence of water transport. When SMIE cells (which endogenously express AQP8) were exposed to hypertonic solutions, they shrunk as a function of time .

  • Transcellular water transport measurements: For polarized epithelial cells expressing rAQP8, net fluid movement across cell monolayers can be measured. SMIE cells grown as polarized monolayers on collagen-coated polycarbonate filters showed 8-25 fold increases in net fluid movement when exposed to hyperosmotic solutions compared to isosmotic conditions .

  • Inhibitor studies: The sensitivity of rAQP8-mediated water transport to known inhibitors (e.g., mercuric chloride) and the ability of reducing agents (e.g., 2-mercaptoethanol) to reverse this inhibition provide functional characterization and help identify key functional residues .

These complementary approaches allow for comprehensive characterization of water transport function in different experimental contexts.

What are the most promising areas for future research on rat AQP8?

Based on current knowledge and gaps in understanding, several promising areas for future research on rat AQP8 include:

  • Structural studies: Despite functional characterization, high-resolution structural information for rat AQP8 remains limited. Future research using X-ray crystallography or cryo-electron microscopy could provide insights into the structural basis of water and ammonia transport specificity.

  • Physiological role in ammonium transport: The observation that AQP8 is permeable to ammonium analogues suggests a potential role in ammonium transport and acid-base balance . Further investigation of this function in physiological contexts, particularly in tissues like the liver where ammonia metabolism is critical, could reveal important roles beyond water transport.

  • Tissue-specific knockout models: While whole-body AQP8-null mice show relatively mild phenotypes , tissue-specific knockout models might reveal more pronounced effects in specific organs or under particular physiological challenges, helping to elucidate the non-redundant functions of AQP8.

  • Regulation by post-translational modifications: Research into how phosphorylation, glycosylation, or other post-translational modifications affect rat AQP8 trafficking, stability, and function could provide insights into dynamic regulation mechanisms.

  • Role in disease models: Investigating AQP8 expression and function in rat models of diseases where fluid homeostasis is disrupted (e.g., inflammatory bowel disease, liver disorders, male fertility issues) could reveal pathophysiological roles and potential therapeutic approaches.

How might differences between rat and human AQP8 impact translational research?

Understanding the differences between rat and human AQP8 is crucial for translational research:

  • Functional differences: While both rat and human AQP8 transport water and are permeable to formamide, subtle differences in transport kinetics, regulatory mechanisms, or interactions with other proteins may affect translational relevance.

  • Expression pattern differences: Species-specific differences in tissue distribution and subcellular localization of AQP8 may impact the relevance of rat models for specific human conditions.

  • Regulatory differences: Differences in promoter regions, transcription factor binding sites, or post-translational modifications between rat and human AQP8 may result in different responses to physiological or pathological stimuli.

  • Pharmacological responses: Species differences in the binding sites for inhibitors or modulators could affect the translational potential of pharmacological findings from rat to human applications.

Researchers should consider these potential differences when designing studies with rat AQP8 intended to inform human health applications, and validation in human systems should be pursued when possible.

What techniques are emerging for studying AQP8 function and regulation?

Several emerging techniques hold promise for advancing the study of AQP8 function and regulation:

  • CRISPR/Cas9 gene editing: This technology allows for precise modification of the AQP8 gene, enabling:

    • Creation of knockout models in various cell types

    • Introduction of specific mutations to study structure-function relationships

    • Tagging of endogenous AQP8 for visualization and purification

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed subcellular localization

    • Live-cell imaging to track AQP8 trafficking in response to stimuli

    • Correlative light and electron microscopy to combine functional and structural information

  • Single-molecule techniques:

    • Single-channel recordings to characterize water and solute transport at the molecular level

    • Single-molecule tracking to study AQP8 dynamics in membranes

    • Single-molecule force spectroscopy to investigate conformational changes

  • Computational approaches:

    • Molecular dynamics simulations to study water and solute transport mechanisms

    • Systems biology approaches to integrate AQP8 function into cellular pathways

    • Machine learning for prediction of regulatory networks involving AQP8

These emerging techniques, combined with established methodologies, will provide more comprehensive insights into AQP8 function and regulation at multiple scales from molecular to physiological.

How can researchers overcome issues with rat AQP8 protein stability during purification?

Maintaining protein stability during purification is critical for obtaining functional rat AQP8. Researchers can address stability issues through:

  • Optimized detergent selection: Different detergents have varying effects on AQP8 stability. Despite the high sequence similarity, rat, human, and mouse AQP8 require different detergents for optimal purification . Systematic testing of detergents (mild non-ionic detergents like DDM, LMNG, or OG) at different concentrations is recommended.

  • Buffer optimization:

    • Include glycerol (10-20%) to stabilize protein structure

    • Add protease inhibitors to prevent degradation

    • Optimize pH and ionic strength for maximum stability

    • Consider including specific lipids that may stabilize the protein

  • Temperature control: Perform all purification steps at 4°C to minimize protein degradation and denaturation.

  • Rapid purification protocol: Minimize the time between cell disruption and final purification to reduce exposure to potentially destabilizing conditions.

  • Addition of stabilizing agents:

    • Cholesterol or other sterols may enhance stability of membrane proteins

    • Specific ligands or inhibitors that bind to AQP8 could stabilize its conformation

    • Consider additives like arginine or trehalose, which can have general stabilizing effects on proteins

  • Pre-crystallization screening: Techniques like thermal shift assays can help identify conditions that enhance protein stability before attempting crystallization or functional studies.

What controls are essential when conducting AQP8 knockout or knockdown experiments?

  • Genetic controls for knockout studies:

    • Wild-type littermates as primary controls

    • Heterozygous animals to assess gene dosage effects

    • Rescue experiments with reintroduction of AQP8 to confirm specificity

  • Controls for siRNA knockdown experiments:

    • Non-targeting siRNA with similar chemical properties

    • Multiple independent siRNAs targeting different regions of AQP8 to rule out off-target effects

    • Dose-response studies to determine optimal siRNA concentration

    • Time-course analysis to identify the point of maximal knockdown

  • Validation of knockout/knockdown efficiency:

    • mRNA level verification by qRT-PCR

    • Protein level verification by Western blotting

    • Functional verification by water permeability assays

  • Phenotypic controls:

    • Careful baseline characterization before intervention

    • Inclusion of established positive controls when assessing specific phenotypes

    • Assessment of potential compensatory mechanisms (e.g., upregulation of other aquaporins)

  • Experimental design considerations:

    • Blinded analysis of results when possible

    • Appropriate statistical analysis based on sample size and data distribution

    • Replication in independent experiments to ensure reproducibility

How can researchers differentiate between AQP8-mediated water transport and other water transport mechanisms?

Differentiating AQP8-mediated water transport from other mechanisms requires specific experimental approaches:

  • Pharmacological inhibition:

    • Mercury compounds (HgCl₂) specifically inhibit AQP8-mediated water transport

    • Reversibility of inhibition with reducing agents like 2-mercaptoethanol confirms AQP8 involvement

    • Use of AQP8-specific inhibitors (when available) compared to inhibitors of other water transport pathways

  • Genetic approaches:

    • Comparison of water transport in wild-type versus AQP8 knockout/knockdown systems

    • Selective expression of AQP8 in AQP-null backgrounds

    • Site-directed mutagenesis of key residues in the AQP8 water pore

  • Biophysical characterization:

    • Temperature dependence (AQP-mediated transport has lower activation energy than lipid diffusion)

    • Calculation of single-channel water permeability

    • Size selectivity of transport (water versus other molecules)

  • Comparative analysis:

    • Side-by-side comparison with other known AQPs

    • Assessment of transport properties in different reconstitution systems

    • Correlation of water permeability with AQP8 expression levels

  • Combined approaches:

    • Integrating functional measurements with localization studies

    • Correlating changes in water transport with alterations in AQP8 expression or localization in response to stimuli

    • Using mathematical modeling to distinguish different transport components

By employing these approaches, researchers can confidently attribute observed water transport phenomena to AQP8 function versus other mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.