Recombinant Rat Atlastin-3 (Atl3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Atl3; Atlastin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Atl3
Target Protein Sequence
MLSPQRTAAVASRGAGDAMENGKPGPVQVVLVHKEQHSFELEERALASVLLQDHIRDLDV VVVSVAGAFRKGKSFILDFMLRYLYSQKEHGHSNWLGDPEEPLTGFSWRGGSDPETTGIQ IWSEVFTVKKPCGKEVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQE DDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYNYGLQGGMSFLDKRLQVKE HQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDGKLKEYIASEFKEQLQTLIPY VLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAANNLAAAASAK DIYYSSMEEICGGEKPYLSPDILEEKHQEFKQLALDHFKKTKKMGGKDFSFRYQQELEEE ITELYENFCKHNGSKNVFSTFRTPAVLFTGIAVLYIASGLTGFIGLEVVAQLFNCMVGLL LIALLTWGYIRYSGQYLELGGAIDSGAAYVLEQASSHIGNSTQAAVRDAIAGRPPADKKS Q
Uniprot No.

Target Background

Function
Atlastin-3 (Atl3) is a GTPase that tethers membranes via the formation of trans-homooligomers and mediates homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Rat Atlastin-3 and what is its primary cellular function?

Rat Atlastin-3 (Atl3) is a GTPase that mediates homotypic fusion of endoplasmic reticulum membranes, playing a fundamental role in ER tubular network biogenesis. It functions by tethering membranes through the formation of trans-homooligomers, which subsequently catalyze membrane fusion . As part of the atlastin family, Atl3 contributes to the maintenance of the interconnected structure of the ER network by facilitating the fusion of ER tubules to form three-way junctions .

Unlike its paralogs (ATL1 and ATL2), recent evidence suggests that ATL3 is a constitutive fusion catalyst that lacks C-terminal autoinhibition, making it uniquely positioned to maintain basal ER network structure without requiring activation steps . This characteristic distinguishes ATL3 from other atlastin family members and points to its specialized role in continuous ER remodeling.

How does the domain architecture of Atlastin-3 support its function?

Atlastin-3, like all atlastin homologs, possesses a conserved domain architecture consisting of:

  • N-terminal GTPase domain: Provides the energy for membrane fusion through GTP hydrolysis

  • Three-helix bundle middle domain: Mediates conformational changes during fusion

  • Hydrophobic membrane anchor: Forms an intramembrane hairpin structure

  • C-terminal cytosolic tail: Involved in regulatory interactions

The membrane anchor is particularly interesting as it forms an intramembrane hairpin that inserts into the ER bilayer. This structural arrangement is critical for proper positioning of the protein during the fusion process. Unlike ATL1 and ATL2, the C-terminal tail of ATL3 does not exhibit autoinhibitory properties, allowing it to function as a constitutive fusogen .

How do Atlastin-3 expression patterns differ across tissues?

The three mammalian atlastin paralogs (ATL1/2/3) show differential expression patterns across tissues. While comprehensive data specifically for rat Atl3 is limited in the provided search results, research on human ATL3 indicates that it has a distinct expression profile compared to ATL1 (predominantly expressed in the central nervous system) and ATL2. Understanding these expression differences is crucial for interpreting the tissue-specific functions of ATL3 and its potential contributions to disease pathology when dysregulated .

What are the optimal methods for expressing and purifying recombinant Rat Atlastin-3?

For successful expression and purification of recombinant Rat Atlastin-3, researchers typically employ the following approach:

  • Expression System: E. coli is commonly used for ATL3 expression, as demonstrated in recent studies

  • Construct Design: Include the full-length protein or relevant domains, depending on experimental goals

  • Purification Strategy: Use affinity chromatography (often with His-tag) followed by size exclusion chromatography

  • Detergent Selection: Critical for maintaining proper folding of membrane-spanning regions

  • Buffer Optimization: Ensure stability of purified protein (typically including GTP/GDP and Mg²⁺)

Several studies have successfully reconstituted ATL3 function in vitro using protein purified from E. coli, confirming that bacterially-expressed protein retains functional activity . The purification protocol must be carefully optimized to maintain the structural integrity of the membrane-spanning regions.

How can one assess the GTPase activity of recombinant Atlastin-3?

The GTPase activity of recombinant Atlastin-3 can be assessed using several complementary approaches:

  • Colorimetric Phosphate Release Assay:

    • Measures inorganic phosphate released during GTP hydrolysis

    • Typically employs malachite green or similar reagents

    • Can determine reaction rates (μmol/min/μmol of protein)

  • HPLC-based Analysis:

    • Separates and quantifies GTP and GDP

    • Provides direct measurement of substrate conversion

  • Radiometric Assays:

    • Uses [γ-³²P]GTP to track hydrolysis

    • Highly sensitive but requires radioisotope handling

Published data shows that Drosophila atlastin exhibits GTPase activity of approximately 2.5-2.8 μmol/min/μmol of protein, providing a reference point for mammalian Atl3 studies . When designing GTPase assays, it's important to include appropriate controls and to consider the effects of lipid environment, as reconstitution into liposomes may affect enzyme kinetics.

What in vitro assays can be used to study Atlastin-3-mediated membrane fusion?

Researchers investigating Atlastin-3 fusion activity typically employ lipid mixing assays with reconstituted proteoliposomes. The standard protocol includes:

  • Proteoliposome Preparation:

    • Reconstitute purified Atl3 into liposomes with ER-like lipid composition

    • Typically maintain protein:lipid molar ratios between 1:200 and 1:400

    • Include fluorescent lipid labels for fusion detection

  • Lipid Mixing Fusion Assay:

    • Mix labeled and unlabeled proteoliposomes

    • Monitor dequenching of fluorescence as fusion occurs

    • Record both initial rates and extent of fusion

  • Content Mixing Assays:

    • Provide more stringent assessment of complete fusion

    • Use encapsulated fluorophores/quenchers in separate populations

When conducting these assays, fusion efficiency should be normalized to protein reconstitution efficiency to ensure accurate comparisons between different conditions or protein variants . Typical experiments include GTP-dependent fusion kinetics and examination of how mutations or interaction partners affect fusion capacity.

How does Atlastin-3 interact with other ER-shaping proteins?

Atlastin-3 functionally and physically interacts with several other ER-shaping proteins, forming a network that collectively maintains ER morphology:

  • Reticulons (e.g., Rtnl1 in Drosophila):

    • Co-immunoprecipitation studies have demonstrated physical interactions between atlastins and reticulons

    • The interaction is likely mediated through membrane-spanning segments

    • Functional interactions have been demonstrated in vivo, where loss of Rtnl1 can partially rescue defects caused by atlastin deficiency

  • REEP/DP1 Proteins:

    • Form part of the ER-shaping protein network

    • May coordinate with atlastins at three-way junctions

Despite evidence for physical interactions, in vitro studies show that co-reconstitution of Drosophila atlastin with reticulon does not significantly affect atlastin's GTPase activity or membrane fusion properties . This suggests that the interactions may serve purposes beyond direct regulation of fusion activity, such as spatial organization or responding to cellular stress conditions.

What are the key differences between ATL3 and other atlastin paralogs in fusion mechanisms?

Recent research has revealed fundamental differences between ATL3 and other atlastin paralogs (ATL1/2):

FeatureATL1/ATL2ATL3
C-terminal inhibitionAutoinhibited by C-terminusNot autoinhibited; constitutively active
Activation requirementRequires relief of autoinhibitionConstitutively fusion-competent
Fusion efficiencyVariable depending on inhibition stateRobust fusion activity at higher concentrations
Evolutionary statusRecent gain of autoinhibitionMaintains ancestral uninhibited state

These differences suggest distinct roles for ATL3 in ER maintenance, potentially serving as a constitutive fusion catalyst while ATL1/2 might be regulated for conditional fusion activities . This functional specialization may explain why conflicting results have been reported regarding ATL3's fusion capabilities in different experimental contexts.

How do disease-associated mutations in ATL3 affect its function?

Several mutations in ATL3 have been linked to hereditary sensory and autonomic neuropathy (HSAN) and hereditary spastic paraplegia (HSP). Analysis of these mutations provides insight into structure-function relationships:

  • Functional Impacts:

    • Disruption of GTPase activity

    • Impaired oligomerization

    • Altered membrane interaction

    • Compromised fusion capability

  • Cellular Consequences:

    • Fragmented ER network morphology

    • Impaired protein targeting to inner nuclear membrane

    • Defects in protein export from ER

    • Disrupted interactions with autophagy machinery

Research suggests that ATL3 interacts with GABARAP proteins as an ER-autophagy receptor, and disease mutations can disrupt this interaction . Additionally, ATL3 has been implicated in both selective and nonselective autophagy through interactions with ULK1 and ATG13 .

How should researchers design experiments to distinguish between ATL3 functions and those of other atlastin paralogs?

To effectively distinguish the specific functions of ATL3 from other atlastin paralogs, consider the following experimental design strategies:

  • Paralog-Specific Knockdown/Knockout:

    • Use siRNA, CRISPR-Cas9, or similar approaches targeting specific paralogs

    • Generate single, double, and triple knockout cell lines to assess compensatory mechanisms

    • Rescue experiments with individual paralogs can reveal specific functions

  • Domain Swap Experiments:

    • Create chimeric proteins exchanging domains between atlastin paralogs

    • Particularly informative for studying C-terminal regulation differences

    • Test fusion activity in reconstituted systems

  • Differential Expression Analysis:

    • Compare tissue expression patterns of different paralogs

    • Identify cell types or conditions where ATL3 is the predominant atlastin

  • Interaction Partner Identification:

    • Perform immunoprecipitation with paralog-specific antibodies

    • Mass spectrometry to identify unique binding partners

    • Validate interactions using proximity ligation assays or FRET

Recent research demonstrates that ATL3 can maintain ER network structure under overexpression conditions, suggesting it can function independently of other paralogs . This provides a foundation for experiments aimed at dissecting paralog-specific roles.

What are the critical controls needed when studying recombinant Atlastin-3 function in vitro?

When studying recombinant Atlastin-3 function, the following controls are essential:

  • For GTPase Activity Assays:

    • Negative control: GTPase-dead mutant (typically K to A mutation in P-loop)

    • Positive control: Known active GTPase with characterized kinetics

    • No-nucleotide control to establish baseline

    • Time-course analysis to ensure linearity of reaction

  • For Membrane Fusion Assays:

    • GTPase-dead mutant to confirm GTP dependence

    • No-protein liposomes to assess spontaneous fusion

    • Different protein:lipid ratios to determine concentration dependence

    • Fusion in the presence of non-hydrolyzable GTP analogs (e.g., GTPγS)

  • For Protein-Protein Interactions:

    • GST-only controls for pull-down experiments

    • IgG controls for immunoprecipitation

    • Competition experiments with unlabeled protein

Research by Jang et al. (2023) demonstrated that ATL3 purified from E. coli can catalyze the fusion of liposomes with ER-like lipid composition, contradicting earlier reports of weak fusion activity . This highlights the importance of appropriate controls and experimental conditions when assessing atlastin function.

How can contradictory findings about Atlastin-3 fusion activity be reconciled?

The literature contains conflicting reports regarding ATL3's fusion capabilities. These contradictions can be reconciled through careful consideration of:

  • Experimental Conditions:

    • Protein concentration variations (ATL3 requires higher concentrations for robust fusion)

    • Lipid composition differences in reconstituted systems

    • Buffer conditions affecting protein activity

    • Detergent selection for membrane protein purification

  • Protein Source and Preparation:

    • Expression system differences (bacterial vs. eukaryotic)

    • Purification method impact on protein conformation

    • Storage conditions affecting activity retention

  • Assay Sensitivity:

    • Different fusion assays have varying sensitivities

    • Time-course measurements may reveal delayed kinetics

    • Normalization to protein reconstitution efficiency

  • Cellular Context:

    • Presence of cofactors or interacting proteins

    • Compensation by other atlastin paralogs in cellular systems

Recent research suggests that ATL3 is indeed a robust fusion catalyst, contrary to earlier studies suggesting weak fusogenic activity . These newer findings propose that ATL3 serves as a constitutive ER fusion catalyst, while ATL1/2 might require activation through relief of autoinhibition .

What are the emerging areas of Atlastin-3 research beyond ER fusion?

Beyond its established role in ER fusion, Atlastin-3 is being investigated in several emerging research areas:

  • Autophagy Regulation:

    • ATL3 has been identified as a potential ER-autophagy receptor

    • Interacts with GABARAP proteins in selective autophagy

    • Involved in nonselective autophagy through ULK1 and ATG13 interactions

  • Protein Trafficking:

    • Implicated in protein targeting to inner nuclear membrane

    • Role in protein export from ER

  • Viral Interactions:

    • Linked to flavivirus replication

    • Interacts with both nonstructural and structural viral proteins

    • Potential target for antiviral therapies

  • Alternative Splicing Regulation:

    • Different Atlastin paralogs possess alternatively spliced isoforms with varying activities

    • Splicing may represent an additional regulatory layer for atlastin function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.