Recombinant Rat ATP-binding cassette sub-family G member 2 (Abcg2)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Rat Abcg2, also known as breast cancer resistance protein (Bcrp), belongs to the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes, utilizing ATP hydrolysis as an energy source. Specifically, Abcg2 is categorized within the White subfamily (subfamily G) of ABC transporters . The gene encoding rat Abcg2 has been successfully cloned from rat brain capillary fractions, providing valuable insights into its structure and function, particularly at the blood-brain barrier (BBB) .

Gene and Protein Information

The rat Abcg2 gene is officially designated as ABCG2, with gene ID 312382. The mRNA reference sequence is documented as NM_181381.2, and the protein reference sequence as NP_852046.1. The UniProt ID for rat Abcg2 is Q80W57 . Table 1 summarizes the key genomic and proteomic information related to rat Abcg2.

Table 1: Key Information about Rat Abcg2

ParameterDetails
Gene NameAbcg2 ATP-binding cassette, subfamily G (WHITE), member 2
Official SymbolABCG2
Gene ID312382
mRNA RefseqNM_181381.2
Protein RefseqNP_852046.1
UniProt IDQ80W57
Common SynonymsABCP, BCRP, BCRP1, CD338, Urate exporter

Synonyms and Alternative Nomenclature

Rat Abcg2 is recognized by several alternative names and acronyms in scientific literature, including Breast Cancer Resistance Protein 1 (Bcrp1), ABC transporter (ABCP), CD338, Urate exporter, and Broad substrate specificity ATP-binding cassette transporter . This diversity in nomenclature reflects the protein's multiple functional roles and the various research contexts in which it has been studied.

Protein Structure and Post-translational Modifications

Rat Abcg2 exists as a glycoprotein complex bridged by disulfide bonds, likely forming a homodimer. This structural arrangement has been confirmed in both rABCG2-transfected HEK293 cells and in rat brain capillary fractions . The glycosylation and disulfide linkages represent critical post-translational modifications that significantly influence the protein's stability, trafficking, and functional properties.

Unlike many other ABC transporters that contain two sets of transmembrane domains and two nucleotide-binding domains within a single polypeptide chain, Abcg2 functions as a half-transporter that must form homo- or heterodimers to achieve functional competence. This structural organization has important implications for the protein's transport mechanism and substrate interactions.

Functional Domains and Motifs

While the search results do not provide detailed information about the specific functional domains of rat Abcg2, as a member of the ABC transporter family, it likely contains characteristic ATP-binding cassette domains that facilitate the binding and hydrolysis of ATP to power substrate transport. Additionally, the protein would possess transmembrane domains that form the substrate translocation pathway across the membrane.

Tissue Distribution

Rat Abcg2 demonstrates significant expression in the brain capillaries, suggesting its importance in blood-brain barrier function . More generally, ABCG2 has been detected at high levels in the placenta (specifically in syncytiotrophoblasts), colon, small intestine, biliary canaliculi, breast tissue, venous endothelium, and capillaries . The expression profile of Abcg2 across various tissues reflects its protective role in preventing the accumulation of potentially harmful xenobiotics in sensitive organs.

Cellular and Subcellular Localization

Immunohistochemical analyses have revealed that rat Abcg2 is predominantly localized on the luminal side of rat brain capillaries . This strategic positioning at the blood-brain interface indicates that Abcg2 functions in the brain-to-blood efflux transport system, effectively pumping potentially harmful substances out of the brain and back into the bloodstream. In other tissues, ABCG2 has been identified in alveolar pneumocytes of the lung, sebaceous glands, intestinal epithelium, bile canaliculi, blood vessels, and the endothelium of the nervous system .

The subcellular localization of Abcg2 at the plasma membrane is crucial for its function as an efflux transporter. Studies have shown that protein kinase AKT may regulate the plasma membrane localization of ABCG2, as inhibition of phosphatidylinositol 3-kinase resulted in the translocation of Abcg2 from the plasma membrane to the cytoplasm .

Transport Properties and Substrate Specificity

Rat Abcg2 functions as a xenobiotic transporter with the capacity to efflux various substrates across cellular membranes. Studies using rABCG2-transfected HEK293 cells have demonstrated that rat Abcg2 can transport mitoxantrone and BODIPY-prazosin , two compounds commonly used to evaluate ABCG2 transport activity. Table 2 summarizes the known substrates and inhibitors of rat Abcg2.

Table 2: Known Substrates and Inhibitors of Rat Abcg2

SubstratesInhibitors
MitoxantroneKo143 (specific ABCG2 inhibitor)
BODIPY-prazosin-
Potentially other xenobiotics, similar to ABCG2 in other species-

Role in Xenobiotic Defense

As a member of the ABC transporter family, rat Abcg2 plays a critical role in xenobiotic defense mechanisms. It functions as a cellular protector by actively effluxing potentially harmful compounds from cells, thereby preventing their accumulation and possible toxic effects. This defensive function is particularly important in sensitive tissues such as the brain, placenta, and stem cell populations .

Role in Blood-Brain Barrier Function

The expression of functional rat Abcg2 on the luminal side of brain capillaries underscores its importance in blood-brain barrier function . By actively effluxing substrates from the brain back into the bloodstream, Abcg2 contributes to the selective permeability of the BBB, protecting the central nervous system from potentially harmful substances while still allowing essential nutrients to enter.

Studies have shown that ABCG2, along with other transporters, forms an integral part of several physiological barriers, including the blood-brain barrier, blood-testis barrier, and maternal-fetal barrier . This protective role is essential for maintaining the homeostasis of these sensitive tissues and preventing damage from xenobiotics.

Transcriptional Regulation

Studies using conditionally immortalized rat brain capillary endothelial (TR-BBB13), astrocyte (TR-AST4), and pericyte (TR-PCT1) cell lines as an in vitro BBB model have provided valuable insights into the regulation of rat Abcg2. Treatment of TR-BBB13 cells with conditioned medium from TR-AST4 cells significantly increased both the Ko143-sensitive transport activity and rABCG2 mRNA levels . This observation suggests that astrocyte-derived soluble factors can upregulate Abcg2 expression at the transcriptional level.

Post-translational Regulation

While specific information about the post-translational regulation of rat Abcg2 is limited in the available literature, studies on ABCG2 in general have indicated that the protein kinase AKT plays a role in regulating the surface expression of the ABCG2 protein . In Akt1-deficient mice, researchers observed a reduced number of cells in the side-population, which represents a distinct population of Abcg2-positive hematopoietic stem cells. When side-population cells from normal mice were treated with the phosphatidylinositol 3-kinase inhibitor LY294002, Abcg2 was found to translocate from the plasma membrane to the cytoplasm, although total protein expression remained unchanged .

Influence of Astrocyte-Derived Factors

The regulatory relationship between astrocytes and rat Abcg2 expression in brain capillary endothelial cells represents an important aspect of BBB function. Conditioned medium from astrocyte cells (TR-AST4) increased both the transport activity and mRNA levels of rat Abcg2 in brain capillary endothelial cells (TR-BBB13), whereas conditioned medium from pericyte cells (TR-PCT1) showed no effect . These findings suggest that rat brain capillaries express functional rABCG2 protein and that the transport activity of the protein is up-regulated by astrocyte-derived soluble factor(s) concomitantly with the induction of rABCG2 mRNA . This regulatory mechanism highlights the importance of astrocyte-endothelial cell interactions in maintaining the integrity and function of the blood-brain barrier.

Expression Systems

Recombinant rat Abcg2 is typically produced in mammalian cell expression systems, which ensure appropriate post-translational modifications such as glycosylation and disulfide bond formation . These modifications are crucial for maintaining the protein's native structure and function. The use of mammalian expression systems provides a significant advantage over bacterial or insect cell systems for producing functionally active rat Abcg2 protein.

Purification and Characteristics

Commercially available recombinant rat Abcg2 products incorporate various affinity tags, such as His and His(Fc)-Avi tags, to facilitate purification . These proteins may be produced as either full-length or partial-length constructs, depending on the specific research requirements. Table 3 summarizes the key characteristics of recombinant rat Abcg2 protein.

Table 3: Characteristics of Recombinant Rat Abcg2 Protein

ParameterDetails
SourceMammalian Cells
Tag OptionsHis, His(Fc)-Avi
FormLiquid or lyophilized powder
Endotoxin Level< 1.0 EU per μg
Purity>80%
Storage BufferPBS buffer
Storage Conditions+4°C (short term); -20°C to -80°C (long term)

Research Applications

Recombinant rat Abcg2 serves as a valuable tool for investigating the structure, function, and regulation of this important transporter. It enables researchers to study substrate specificity, transport mechanisms, and interactions with potential inhibitors or modulators. Such studies are essential for understanding the role of Abcg2 in drug disposition and for developing strategies to overcome Abcg2-mediated drug resistance.

Drug Development and Screening

Given the significant role of Abcg2 in multi-drug resistance and its presence at various physiological barriers, recombinant rat Abcg2 can be employed to screen potential drug candidates for interactions with this transporter. This information is invaluable for predicting drug disposition, potential drug-drug interactions, and the likelihood of drug resistance mediated by Abcg2.

Detection Methods (ELISA)

Several ELISA kits are commercially available for detecting rat Abcg2 in various sample types, including serum, plasma, cell culture supernatant, cell or tissue lysate, and other biological fluids . These assays are based on the double antibody-sandwich ELISA method and typically require approximately 4 hours to complete. Table 4 compares the specifications of two commercially available rat Abcg2 ELISA kits.

Role in Normal Physiology

Rat Abcg2, like its homologs in other species, plays critical roles in various physiological processes. It contributes to protection against xenobiotics, regulation of oral bioavailability of substrates, and formation of physiological barriers, including the blood-brain barrier, blood-testis barrier, and maternal-fetal barrier . The expression of Abcg2 in stem cell populations suggests an important role in protecting these cells from potentially harmful compounds .

Implications in Drug Resistance

As its alternative name "breast cancer resistance protein" suggests, Abcg2 functions as a xenobiotic transporter that plays a significant role in multi-drug resistance . It serves as a cellular defense mechanism, particularly in response to mitoxantrone and anthracycline exposure . While this function is protective in normal physiology, it can complicate cancer treatment by reducing the intracellular accumulation of chemotherapeutic agents.

Insights from Knockout Models

Studies with Bcrp/Pgp double knock-out (dKO) rats have provided valuable insights into the systemic impact of Abcg2 ablation on metabolic homeostasis. The cerebrospinal fluid (CSF) and plasma levels of 169 metabolites, nutrients, signaling molecules, antioxidants, and lipids were significantly altered in dKO rats compared to wild-type rats . These metabolite changes suggested alterations in histidine, branched-chain amino acid, purine, and pyrimidine metabolism in the dKO rats . Table 5 summarizes the key alterations observed in rats lacking Abcg2 (and Abcb1a).

Table 5: Alterations in Rats Lacking Abcg2 (and Abcb1a)

ParameterObservations in Knockout Rats
MetabolitesSignificant alterations in 169 metabolites in CSF and plasma
Affected PathwaysHistidine, branched chain amino acid, purine and pyrimidine metabolism
Specific ChangesIncreased levels of methylated and sulfated metabolites; elevated uric acid
CNS ImpactAlterations in antioxidants, neurotransmitter precursors, and uric acid
Microbiome InteractionElevated microbiome-generated metabolites in plasma and CSF

Levels of methylated and sulfated metabolites and some primary bile acids were increased in dKO CSF or plasma, and elevated uric acid levels appeared to be a primary driver of changes in purine and pyrimidine biosynthesis . The alterations in dKO CSF levels of antioxidants, precursors of neurotransmitters, and uric acid suggest that these transporters, including Abcg2, may contribute to the regulation of a healthy central nervous system in rats .

Additionally, microbiome-generated metabolites were found to be elevated in dKO rat plasma and CSF, suggesting potential interactions between Abcg2 and the gut microbiome . These findings from knockout models highlight the broad physiological impact of Abcg2 beyond its role in drug transport.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Abcg2; Bcrp1; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein 1 homolog; Urate exporter; CD antigen CD338
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-657
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSSSNDHVLVPMSQRNKNGLPGMSSRGARTLAEGDVLSFHHITYRVKVKSGFLVRKTAEK EILSDINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPRGLSGDVLINGAPQPANFKCSS GYVVQDDVVMGTLTVRENLQFSAALRLPKAMKTHEKNERINTIIKELGLDKVADSKVGTQ FTRGISGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIFS IHQPRYSIFKLFDSLTLLASGKLMFHGPAQKALEYFASAGYHCEPYNNPADFFLDVINGD SSAVMLNRGEQDHEANKTEEPSKREKPIIENLAEFYINSTIYGETKAELDQLPVAQKKKG SSAFREPVYVTSFCHQLRWIARRSFKNLLGNPQASVAQLIVTVILGLIIGALYFGLKNDP TGMQNRAGVFFFLTTNQCFTSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKLVSDLLP MRFLPSVIYTCILYFMLGLKRTVEAFFIMMFTLIMVAYTASSMALAIAAGQSVVSVATLL MTISFVFMMLFSGLLVNLRTIGPWLSWLQYFSIPRYGFTALQHNEFLGQEFCPGLNVTMN STCVNSYTICTGNDYLINQGIDLSPWGLWRNHVALACMIIIFLTIAYLKLLFLKKYS
Uniprot No.

Target Background

Function
ABCG2, also known as Breast Cancer Resistance Protein (BCRP), is an ATP-dependent transporter belonging to the ATP-binding cassette (ABC) family. It plays a crucial role in actively extruding a wide array of physiological compounds, dietary toxins, and xenobiotics from cells. This transporter is involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to the cytosol and the cytosol to the extracellular space. It also contributes to the cellular export of heme. Additionally, ABCG2 mediates the efflux of sphingosine-1-P from cells. It serves as a urate exporter, participating in both renal and extrarenal urate excretion. Within the kidney, it functions as a physiological exporter of the uremic toxin indoxyl sulfate. ABCG2 is further involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. It mediates the secretion of riboflavin and biotin vitamins into milk. ABCG2 effectively extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, minimizing its bioavailability. It plays a significant role in excluding xenobiotics from the brain. This transporter confers resistance to multiple drugs and other xenobiotics, including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the regulation of their efflux. In the placenta, ABCG2 restricts the penetration of drugs from maternal plasma into the fetus. It may play a role in early stem cell self-renewal by inhibiting differentiation.
Gene References Into Functions
  1. The ROS-mediated increase in the synthesis of MRP-1 and BCRP can play a significant role in hyperoxaluria-promoted calcium oxalate urolithiasis by facilitating phosphatidylserine redistribution in renal epithelial cells. PMID: 28577929
  2. In conclusion, MDR1 and BCRP are expressed on apical membranes of the rodent placental SynT-II layer. PMID: 27616577
  3. Parathryoid hormone down-regulates ABCG2 expression on the plasma membrane to suppress intestinal and renal urate excretion in secondary hyperparathyroidism leading to hyperuricemia. PMID: 27988213
  4. Insulin significantly increased URAT1 and decreased ABCG2 levels, resulting in increased kidney tubule uric acid reabsorption in streptozotocin-diabetic rats. PMID: 28679589
  5. Unconjugated Bilirubin elevation in Bile Duct Ligated rats impairs the function and expression of breast cancer resistance protein at the Blood-Brain-Barrier, thus contributing to hepatic encephalopathy. PMID: 27180978
  6. Olomoucine II, but not purvalanol A placental passage is affected by p-glycoprotein (ABCB1), breast cancer resistance protein (ABCG2) and multidrug resistance-associated proteins (ABCCs). PMID: 26364927
  7. Cilostazol inhibits ABCG2 activity increasing donezapil accumulation in the heart and resulting in cardiotoxicity. PMID: 26467765
  8. Tetronic 904-containing polymeric micelles overcame the overexpression of ABCG2 in the BBB caused by chronic administration of EFV then boosting its penetration into the CNS PMID: 26252052
  9. In 5/6 nephrectomy model of chronic kidney disease rats exhibited lower excretion of urine uric acid and over-expression of ABCG2 in the ileum. PMID: 23584883
  10. Data suggest that, with aging, up-regulation of reactive oxygen species derived from xanthine oxidase down-regulates uric acid excretion via down-regulation of active homodimer Bcrp1/Abcg2 which is uric acid efflux transporter in ileal mucosa. PMID: 26119820
  11. These findings suggest that Bcrp may be involved in the cellular export of select mercuric species PMID: 25868844
  12. Hepatic BCRP expression and function were oppositely regulated in type 1 and type 2 diabetic models. PMID: 24342797
  13. Bcrp is localized to the endothelial TJ barrier in microvessels at the interstitium and also the peritubular myoid cells in the testis, but not at the Sertoli cell BTB. Bcrp regulates the configuration of the actin filament bundles at the apical ES. PMID: 23403943
  14. It may be concluded that BCRP plays an important role in the intestinal efflux of MED-5 and limits the bioavailability after oral administration of MED-15. PMID: 23333829
  15. Impaired hepatic CYP2C11 and intestinal BCRP expression and activity induced by diabetes contributes to the increased exposure of orally administered glibenclamide. PMID: 22393122
  16. Report drug metabolizing phenotype of Bcrp knockout rats. PMID: 22711747
  17. The Abcg2(-/-) rat is a useful model for understanding the role of breast cancer resistance protein in elimination and oral absorption PMID: 22869929
  18. These findings indicate similar Abcg2 transporter expression, function, and regulation at the blood-spinal cord and blood-brain barriers. PMID: 22472606
  19. Butyrate (BT) is a BCRP substrate. It is very important in the context of the high levels of BCRP expression in the human colon and the anticarcinogenic and anti-inflammatory role of BT at that level. PMID: 21775706
  20. It was suggested that the oral absorption of efavirenz is affected by modifications in the ABCG2 intestinal expression contributing to the intra-individual bioavailability variations. PMID: 21803024
  21. Consistent with protein expression data, no changes in diabetic rats occurred, suggesting an unaltered function of brain bcrp. PMID: 21075088
  22. investigation of expression and function of BCRP in rat liver; decreased biliary excretion in some genetically modified rat models may be attributed to decreased BCRP expression PMID: 21106720
  23. Nanomolar concentrations of 17-beta-estradiol (E2) rapidly reduced BCRP1 transport activity in the brain capillaries. PMID: 20216549
  24. Hepatic oval cells express high levels of MDR1, MRP1 and Bcrp1 genes which may have cytoprotective functions during severe hepatotoxicity. PMID: 17669244
  25. These results indicate that hepatic oval cells have a phenotype defined by expression of ATP-binding cassette transporter ABCG2/BCRP1, suggesting that oval cells may represent stem cells in the liver. PMID: 12819005
  26. These results suggest that rat brain capillaries express functional rABCG2 protein and that the transport activity of the protein is up-regulated by astrocyte-derived soluble factor(s) concomitantly with the induction of rABCG2 mRNA PMID: 15255930
  27. Has an important role in extruding glucuronide and sulfate conjugates formed in enterocytes into the intestinal lumen. PMID: 15598971
  28. progesterone plays a role in reduction in the expression level of ABCG2 in the placenta with the advance of gestation from the mid stage to the end of gestation PMID: 16244436
  29. a two-level defensive role of Bcrp in the rat placenta in which the transporter 1) reduces passage of its substrates from mother to fetus but also 2) removes the drug already present in the fetal circulation. PMID: 16809480
  30. Show low endogenous ABCG2 protein expression, localization and activity in cultures of rat brain microvessel endothelial and glial cells. PMID: 17380269
  31. we demonstrate for the first time that ABCG2 is a target of Notch signaling, and as such, constitutes one of the genes in the regulatory network of Notch signaling, involved in the maintenance of stem cells. PMID: 17635990
  32. The rat fetus is protected by Bcrp against potentially detrimental substances from gestational day 15 onwards. PMID: 18450391
  33. Curcumin may be used to enhance drug exposure when the rate-limiting step of drug absorption and/or tissue distribution is impacted by ABCG2. PMID: 18841445

Show More

Hide All

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brain capillary, kidney and small intestine. Lower expression in heart. Preferentially expressed (at protein level) on the luminal membrane of brain capillaries, in kidney and small intestine.

Q&A

What is Rat Abcg2 and what is its biological significance?

Rat ATP-binding cassette sub-family G member 2 (Abcg2), also known as breast cancer resistance protein 1 (Bcrp1) or CD338, is a member of the highly conserved ABC transporter superfamily. It functions as a half-transporter that forms functional homodimers or possibly higher-order multimers in the plasma membrane. Abcg2 acts as a xenobiotic efflux transporter, playing a crucial role in multidrug resistance and protection against xenobiotics .

The biological significance of Abcg2 extends across multiple physiological systems, as it is expressed in various tissues including the small intestine, liver, placenta, mammary gland, brain, kidney, and testis . Its wide distribution highlights its importance in tissue protection and homeostasis maintenance. Research suggests potential involvement in early embryonic development and redox homeostasis, though these roles require further investigation .

How does Abcg2 structure relate to its function?

The rat Abcg2 protein consists of 657 amino acids forming a half-transporter structure. Unlike full transporters such as ABCB1 (P-glycoprotein), Abcg2 contains a single nucleotide-binding domain (NBD) and a single transmembrane domain (TMD), requiring dimerization for functionality . The protein contains an ATP-binding cassette that enables energized transport across membranes.

The amino acid sequence contains multiple functional regions:

  • Nucleotide-binding domains that interact with ATP

  • Transmembrane domains forming the substrate translocation pathway

  • Dimerization interfaces facilitating functional assembly

This structure enables Abcg2 to recognize and transport a wide variety of substrates out of cells, including chemotherapeutic drugs, xenobiotics, and endogenous compounds. Mutations or variations in key structural regions can significantly alter transport efficiency and substrate specificity .

What methods are available for measuring Abcg2 activity in rat samples?

Several complementary methodologies can be employed to assess Abcg2 activity in rat samples:

  • Fluorescent substrate assays: Pheophorbide a-based fluorescent assays can be used to measure Abcg2 transport activity. This approach allows researchers to monitor substrate efflux in real-time .

  • ATPase assays: These assays measure the ATP hydrolysis associated with substrate transport. For example, in studies with oxycodone, Abcg2 ATPase assays were used to determine if the compound behaved as a substrate .

  • Pharmacological inhibition studies: Using selective Abcg2 inhibitors in conjunction with transport assays allows researchers to confirm transporter specificity. This approach was utilized in studies examining the role of Abcg2 in mouse embryonic stem cells .

  • ELISA-based quantification: Commercially available ELISA kits can detect native Abcg2 in various sample types, including body fluids and tissue homogenates. These typically employ a biotin-conjugated antibody specific to Abcg2, followed by avidin-HRP detection systems .

  • Capillary-based immunoassay: This technique provides sensitive protein expression measurement with minimal sample requirements .

It is recommended to use multiple complementary techniques to generate robust data on Abcg2 activity, as each method has specific strengths and limitations.

What are optimal conditions for recombinant rat Abcg2 expression and purification?

Successful expression and purification of recombinant rat Abcg2 require careful optimization of several parameters:

Expression Systems:

  • E. coli: While commonly used for other ABC transporters, membrane proteins like Abcg2 often face folding challenges in bacterial systems.

  • Mammalian cell lines: These provide proper post-translational modifications but have lower yields.

  • Insect cells: Often represent an optimal compromise between proper folding and reasonable yields.

Purification Considerations:

  • Buffer composition typically includes Tris-based buffers with 50% glycerol for stability .

  • Storage at -20°C is recommended, with working aliquots maintained at 4°C for up to one week to prevent degradation through repeated freeze-thaw cycles .

  • For solubilization, detergent selection is critical, with mild non-ionic detergents often preferred.

Stabilization Strategies:

  • Addition of 50% glycerol to storage buffer enhances protein stability .

  • Inclusion of specific lipids that mimic the native membrane environment can improve functional integrity.

  • Avoiding repeated freeze-thaw cycles is essential for maintaining activity .

Researchers should verify protein quality through SDS-PAGE (aiming for >90% purity) and functional assays before proceeding with experiments .

How should researchers design transport assays to evaluate rat Abcg2 substrate specificity?

Designing robust transport assays for rat Abcg2 substrate specificity requires careful consideration of multiple factors:

Assay Components:

  • Membrane vesicles or whole cells: Choose based on research questions - vesicles offer direct access to transporters while whole cells provide physiological relevance.

  • ATP regeneration system: Include creatine phosphokinase and creatine phosphate to maintain ATP levels during longer assays.

  • Control conditions: Always include ATP-free conditions as negative controls.

Methodological Approach:

  • Direct transport measurement: Monitor movement of fluorescent substrates like Pheophorbide a across membranes .

  • Cytotoxicity assays: Evaluate whether Abcg2 confers resistance to potential substrate compounds.

  • ATPase stimulation assays: Measure ATP hydrolysis rates in the presence of potential substrates, as demonstrated in oxycodone studies .

Validation Strategies:

  • Use established Abcg2 inhibitors (e.g., Ko143, fumitremorgin C) as positive controls.

  • Include known Abcg2 substrates as reference compounds.

  • Apply multiple complementary assay systems to confirm findings.

A critical consideration is substrate concentration - as observed with oxycodone, some compounds only behave as Abcg2 substrates at higher concentrations (≥500 μM) . Therefore, testing across a concentration range is essential for comprehensive characterization.

What controls are essential when studying Abcg2 expression in developmental or drug response studies?

When investigating Abcg2 expression changes during development or in response to drug treatment, several critical controls must be implemented:

For Developmental Studies:

  • Temporal controls: Sample multiple timepoints to establish expression patterns.

  • Tissue-specific controls: Compare expression across multiple tissues, as Abcg2 shows tissue-specific distribution in small intestine, liver, placenta, mammary gland, brain, kidney, and testis .

  • Related transporter controls: Measure expression of related transporters (ABCB1, ABCC1) to distinguish Abcg2-specific effects .

For Drug Response Studies:

  • Dose-response controls: As seen with oxycodone, effects may be concentration-dependent (≥500 μM for substrate behavior) .

  • Time-course controls: Collect samples at multiple timepoints to distinguish acute vs. chronic effects.

  • Vehicle controls: Include appropriate vehicle treatments to control for non-specific effects.

Methodological Controls:

  • Multiple detection methods: Combine techniques like qRT-PCR for mRNA and capillary-based immunoassay for protein to ensure comprehensive analysis .

  • Housekeeping gene selection: Validate stability of reference genes under experimental conditions.

  • Functional validation: Confirm that expression changes correlate with altered transporter function using activity assays .

In the oxycodone study, researchers validated microarray findings with qRT-PCR, demonstrating a strong correlation (r = 0.979, p < 0.0000001) between methods, which represents a best practice approach .

How does Abcg2 interact with the cellular redox system during development?

The relationship between Abcg2 and cellular redox homeostasis represents an emerging area of research with important developmental implications:

Current Evidence:
Research suggests an association between xenobiotic exposure that regulates Abcg2 transcription and differentiation of mouse embryonic stem cells (mESCs), with this relationship potentially linked to redox homeostasis mechanisms . While not directly studied in rat models, similar mechanisms likely exist across rodent species.

Proposed Mechanisms:

  • Protection against oxidative stress: Abcg2 may efflux oxidized glutathione and other oxidative byproducts, reducing cellular oxidative burden.

  • Heme/porphyrin homeostasis: Given that Pheophorbide a (a porphyrin derivative) is a substrate for Abcg2, the transporter may regulate intracellular levels of redox-active porphyrins .

  • Xenobiotic detoxification: By eliminating compounds that could generate reactive oxygen species, Abcg2 may indirectly maintain redox balance.

Experimental Approaches:
To investigate these interactions, researchers should consider:

  • Measuring redox status markers (GSH/GSSG ratio, ROS levels) while modulating Abcg2 activity.

  • Examining Abcg2 expression and activity in response to oxidative challenges.

  • Comparing the effects of Abcg2 inhibition during stem cell differentiation under various redox conditions.

This research area has significant implications for understanding developmental toxicology and embryonic stem cell biology, particularly in contexts of xenobiotic exposure .

What is the role of Abcg2 in drug-induced transcriptional networks?

Abcg2 participates in complex drug-induced transcriptional networks, functioning as both a target and regulator:

Transcriptional Regulation of Abcg2:
Microarray analysis of brain tissues from rats repeatedly treated with oxycodone revealed significant upregulation of Abcg2 mRNA (2.1-fold increase), which was confirmed by protein analysis (1.8-fold upregulation) . This demonstrates that Abcg2 expression responds to xenobiotic exposure through transcriptional mechanisms.

Broader Network Interactions:
Computational analysis using platforms like MetaCore identified several biological processes associated with drug-induced gene regulation networks involving Abcg2:

  • Organic anion transport (p = 7.251 × 10⁻⁴)

  • Regulation of immune response (p = 5.090 × 10⁻⁴)

Functional Consequences:
The upregulation of Abcg2 following drug exposure has functional implications for:

  • Drug disposition - increased expression may enhance drug efflux, potentially leading to tolerance.

  • Altered brain uptake - changes in Abcg2 activity can modify CNS drug exposure.

  • Cross-tolerance - upregulation may affect transport of other Abcg2 substrates.

Research Methodology:
To effectively study these networks, researchers should:

  • Combine transcriptomics (microarray, RNA-seq) with protein expression studies .

  • Validate findings using multiple techniques (e.g., qPCR validation of microarray results).

  • Apply computational pathway analysis to identify coordinated gene expression changes.

  • Verify functional consequences through transport and pharmacological studies.

How do post-translational modifications affect rat Abcg2 function?

Post-translational modifications (PTMs) critically influence Abcg2 function, though specific data on rat Abcg2 PTMs remains limited:

Key Modification Types:

  • Glycosylation: N-linked glycosylation affects protein folding, trafficking, and stability. The rat Abcg2 sequence contains potential N-glycosylation sites that likely impact membrane localization.

  • Phosphorylation: Phosphorylation at specific serine, threonine, or tyrosine residues can modulate transport activity and regulatory interactions.

  • Ubiquitination: This modification regulates protein degradation pathways and membrane turnover rates.

Methodological Approaches:
To study PTMs in rat Abcg2, researchers should consider:

  • Mass spectrometry analysis of purified protein to identify specific modified residues.

  • Site-directed mutagenesis of potential modification sites to assess functional significance.

  • Inhibitor studies using compounds that block specific PTM pathways.

  • Immunoprecipitation followed by PTM-specific antibody detection.

When working with recombinant rat Abcg2, researchers should note that the expression system dramatically influences PTM patterns - E. coli systems lack mammalian glycosylation machinery, while insect and mammalian cell systems provide more native-like modifications .

Research Implications:
Understanding PTM patterns is particularly important when:

  • Comparing results across different expression systems

  • Investigating drug interactions that might be influenced by specific PTMs

  • Examining regulatory mechanisms that control Abcg2 activity

How should researchers reconcile contradictory findings on Abcg2 substrate specificity?

Contradictory findings regarding Abcg2 substrate specificity are common in the literature and require careful methodological consideration:

Sources of Variation:

  • Concentration dependencies: Compounds like oxycodone may behave as Abcg2 substrates only at higher concentrations (≥500 μM), highlighting the importance of testing across concentration ranges .

  • Species differences: While rat Abcg2 shares high homology with human ABCG2, subtle structural differences can affect substrate specificity.

  • Experimental system variations: Membrane vesicles, cell lines, and in vivo models may yield different results due to differences in membrane composition, expression levels, and presence of other transporters.

Resolution Strategies:
To address contradictory findings, researchers should:

  • Standardize assay conditions: Use consistent buffer compositions, temperature, and incubation times across studies.

  • Employ multiple assay systems: Combine direct transport, ATPase, and cytotoxicity assays to build a comprehensive profile .

  • Consider transporter cooperativity: Examine interactions with other transporters, as Abcg2 may function cooperatively with ABCB1 or ABCC1 .

  • Perform structure-activity relationship studies: Systematically investigate how structural modifications affect substrate recognition.

Interpretation Framework:
When evaluating contradictory findings, consider organizing data in a hierarchical framework:

Evidence LevelDescriptionExamplesLimitations
Level 1Direct transport measurementFluorescent substrate accumulationTechnical complexity
Level 2ATPase stimulationOxycodone ATPase assays Indirect measure of transport
Level 3Resistance correlationCell survival with/without inhibitorMultiple mechanisms possible
Level 4In silico predictionComputational modelingRequires validation

This framework helps researchers weigh contradictory evidence based on methodological strength.

What methodological factors affect quantification of Abcg2 expression levels?

Accurate quantification of Abcg2 expression is essential but subject to several methodological variables that researchers must consider:

RNA-Level Quantification Considerations:

  • Primer design: Primers must be specific to rat Abcg2, avoiding cross-reactivity with other ABC transporters.

  • Reference gene selection: Studies showing strong correlation between qPCR and microarray data (r = 0.979, p < 0.0000001) highlight the importance of appropriate reference genes .

  • RNA quality: Degraded RNA can significantly impact quantification accuracy.

Protein-Level Quantification Variables:

  • Antibody specificity: Antibodies must be validated for rat Abcg2 specificity, ideally using knockout controls.

  • Membrane protein extraction efficiency: Different extraction methods may yield variable recovery of membrane-bound Abcg2.

  • Detection method sensitivity: Capillary-based immunoassays may offer greater sensitivity than traditional Western blotting .

ELISA-Based Detection Factors:
When using ELISA kits for Abcg2 detection:

  • The assay design (sandwich ELISA with biotin-conjugated antibody and avidin-HRP) affects specificity and sensitivity .

  • Sample preparation is critical - most kits are designed for native, not recombinant, Abcg2 detection .

  • The detection range must be appropriate for the expected expression level in the sample type.

Standardization Recommendations:
To enhance comparability across studies, researchers should:

  • Include positive control samples with known Abcg2 expression levels.

  • Report detailed methodological parameters, including antibody catalog numbers, primer sequences, and extraction protocols.

  • Validate findings using complementary methods (e.g., combining qPCR, Western blot, and functional assays) .

How can researchers optimize storage conditions for maintaining rat Abcg2 activity?

Maintaining the structural integrity and functional activity of recombinant rat Abcg2 requires careful attention to storage conditions:

Critical Storage Parameters:

  • Temperature: Store stock solutions at -20°C/-80°C, with working aliquots at 4°C for up to one week .

  • Buffer composition: Tris-based buffers with 50% glycerol at pH 8.0 help maintain protein stability .

  • Aliquoting strategy: Prepare single-use aliquots to avoid repeated freeze-thaw cycles, which significantly reduce activity .

Reconstitution Guidance:
For lyophilized recombinant Abcg2:

  • Briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL.

  • Add glycerol to 5-50% final concentration for long-term storage.

  • Default recommendation is 50% glycerol final concentration .

Stability Monitoring Approaches:
To verify maintained activity after storage:

  • Perform functional assays (e.g., ATPase activity or substrate transport) before and after storage periods.

  • Check for aggregation using size-exclusion chromatography or dynamic light scattering.

  • Assess secondary structure preservation using circular dichroism spectroscopy.

Comparison of Storage Methods:

Storage MethodAdvantagesDisadvantagesRecommended Duration
-80°C, 50% glycerolMaximum stabilityRequires deep freezerUp to 1 year
-20°C, 50% glycerolGood stability, standard freezerSome activity loss over timeUp to 6 months
4°C working solutionReady to useSignificant activity lossUp to 1 week
Lyophilized powderExtended shelf-lifeRequires reconstitutionAccording to expiration date

These recommendations are based on general practices for recombinant ABC transporters, including specific guidance for rat Abcg2 .

What emerging technologies can advance rat Abcg2 research?

Several cutting-edge technologies show promise for advancing our understanding of rat Abcg2 structure, function, and regulation:

Structural Biology Approaches:

  • Cryo-electron microscopy (cryo-EM): This technique can provide high-resolution structures of membrane proteins like Abcg2 in near-native environments, revealing conformational states during the transport cycle.

  • HDX-MS (Hydrogen Deuterium Exchange Mass Spectrometry): Enables mapping of dynamic protein regions and conformational changes upon substrate binding.

Functional Analysis Technologies:

  • Organ-on-chip models: These microfluidic systems can recreate tissue-specific environments to study Abcg2 function in more physiologically relevant contexts than traditional cell cultures.

  • Real-time intracellular imaging: Using fluorescent substrate analogs with advanced microscopy to track transport kinetics at the single-cell level.

Genetic Manipulation Tools:

  • CRISPR-Cas9 genome editing: Enables precise modification of the Abcg2 gene to study structure-function relationships and regulatory elements.

  • Conditional knockout models: Allow tissue- and time-specific deletion of Abcg2 to examine developmental and physiological roles.

Computational Approaches:

  • Molecular dynamics simulations: Can provide insights into substrate binding and translocation mechanisms.

  • Systems biology integration: Combining transcriptomics, proteomics, and metabolomics data to understand Abcg2's role in broader cellular networks, similar to the pathway analysis conducted in oxycodone studies .

These technologies have the potential to address key knowledge gaps, particularly in understanding how Abcg2 contributes to developmental processes and redox homeostasis , as well as its dynamic regulation in response to xenobiotics .

How might comparative studies between rat and human Abcg2 inform translational research?

Comparative studies between rat and human Abcg2 provide valuable insights for translational research, highlighting both opportunities and limitations:

Structural and Functional Comparisons:

  • Sequence homology: While rat and human Abcg2 share high sequence similarity, key differences in the substrate-binding pocket may affect drug interactions.

  • Substrate specificity overlap: Systematic comparison studies are needed to identify compounds that interact differently with rat versus human transporters.

  • Tissue distribution patterns: Comparative expression mapping across species can reveal evolutionary conservation of physiological roles.

Translational Considerations:

  • Predictive validity: Understanding species differences helps determine when rat models are appropriate for predicting human drug interactions.

  • Safety assessment: Species-specific transport differences may explain discrepancies in toxicity profiles between preclinical and clinical studies.

  • Pharmacokinetic modeling: Incorporating species-specific Abcg2 parameters improves translation of rat PK data to humans.

Methodological Approach:
A comprehensive comparison should include:

  • Side-by-side transport assays using identical methodologies

  • Structural studies to identify critical amino acid differences

  • In vivo pharmacokinetic studies with probe substrates

  • Comparative analysis of transcriptional regulation

Research Applications:
This comparative approach is particularly valuable for:

  • Drug development programs using rat models for early pharmacokinetic assessment

  • Understanding evolutionary conservation of Abcg2's role in development and stem cell biology

  • Interpreting xenobiotic-induced changes in transporter expression

By systematically documenting species differences and similarities, researchers can develop more accurate translational paradigms for Abcg2-mediated transport processes.

How can researchers effectively use rat Abcg2 in drug resistance and bioavailability studies?

Rat Abcg2 serves as an excellent model for investigating drug resistance mechanisms and bioavailability determinants, with several practical applications:

Experimental Applications:

  • Screening drug candidates: Early assessment of whether new compounds are Abcg2 substrates helps predict potential bioavailability limitations and resistance development.

  • Developing circumvention strategies: Testing Abcg2 inhibitors as adjuvants to improve delivery of anticancer or CNS-targeted drugs.

  • Exploring drug-drug interactions: Investigating whether co-administered compounds compete for Abcg2-mediated transport.

Methodological Framework:
For effective use of rat Abcg2 in drug studies:

  • In vitro transport studies:

    • Use transfected cell lines overexpressing rat Abcg2

    • Compare transport with and without specific inhibitors

    • Test concentration-dependent effects, as seen with oxycodone

  • Ex vivo tissue studies:

    • Use intestinal sacs or brain capillary isolates to examine tissue-specific transport

    • Apply dual perfusion techniques to quantify directional transport

  • In vivo pharmacokinetic studies:

    • Compare drug disposition in wild-type versus Abcg2-inhibited conditions

    • Assess brain uptake using microdialysis or brain/plasma ratios

Data Interpretation Guidelines:
When evaluating Abcg2's impact on drug properties, consider:

  • The efflux ratio (basolateral-to-apical vs. apical-to-basolateral transport)

  • The inhibitor sensitivity ratio (transport with/without Abcg2 inhibitors)

  • Concentration-dependent effects, as some compounds only behave as substrates at higher concentrations

  • Species differences when extrapolating to human scenarios

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.