Recombinant Rat ATP-binding cassette sub-family G member 5 (Abcg5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Abcg5

Recombinant Rat ATP-binding cassette sub-family G member 5 (Abcg5) is a genetically engineered protein produced to study the structural and functional roles of Abcg5 in sterol transport. As part of the ABCG transporter family, Abcg5 forms an obligate heterodimer with Abcg8 to mediate biliary and intestinal secretion of cholesterol and dietary xenosterols . Its recombinant form enables biochemical, immunological, and pharmacological investigations into lipid metabolism disorders such as sitosterolemia .

Functional Role in Sterol Transport

Abcg5/Abcg8 regulates sterol homeostasis through two primary mechanisms:

  1. Biliary Cholesterol Secretion: In hepatocytes, the heterodimer mediates ATP-dependent cholesterol efflux into bile. Disruption in mice reduces biliary cholesterol by >90% .

  2. Intestinal Sterol Excretion: Limits absorption of plant sterols (e.g., sitosterol) by pumping them back into the intestinal lumen .

Functional AspectImpact of Abcg5/Abcg8 Deficiency
Plasma Sterol Levels30-fold increase in sitosterol
Biliary Cholesterol SecretionReduced from 5.5 μmol/ml (WT) to 0.4 μmol/ml
Dietary Sterol Absorption2- to 3-fold increase in plant sterols
  • Catalytic Asymmetry: The heterodimer exhibits functional asymmetry in ATP hydrolysis. Mutations in Abcg5’s Walker A/B motifs abolish sterol transport, while analogous Abcg8 mutations have no effect .

  • Disease Relevance:

    • Sitosterolemia-linked mutations (e.g., R419Q in Abcg5) map near the sterol-binding pocket, impairing substrate selectivity .

    • Abcg5−/−/Abcg8−/− mice show hepatic cholesterol accumulation (18-fold increase) under high-cholesterol diets .

  • Structural Insights: The crystal structure of Abcg5/Abcg8 (PDB: 5DO7) reveals a sterol-binding pocket formed by TMD helices, explaining substrate specificity .

Applications in Research

  • Antibody Development: Mouse monoclonal antibodies (e.g., Clone 1B5E10) enable Western blot, immunohistochemistry, and flow cytometry to study Abcg5 localization .

  • Drug Discovery: Used to screen compounds modulating sterol transport, relevant to atherosclerosis and gallstone disease .

  • Mechanistic Studies: Recombinant Abcg5 facilitates in vitro assays to dissect ATPase activity and sterol-binding kinetics .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Abcg5; ATP-binding cassette sub-family G member 5; Sterolin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-652
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSELPFLSPEGARGPHNNRGSQSSLEEGSVTGSEARHSLGVLNVSFSVSNRVGPWWNIKS CQQKWDRKILKDVSLYIESGQTMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCVSYLLQSDVFLSSLTVRETLRYTAMLALRSSSADFYDKKVEAVLTELSLSH VADQMIGNYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANHIVLLLVELA RRNRIVIVTIHQPRSELFHHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLESAFRQSDICHKILENIERTRHLKTLPMVPFKTK NPPGMFCKLGVLLRRVTRNLMRNKQVVIMRLVQNLIMGLFLIFYLLRVQNNMLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYQKWQMLLAYVLHALPFSIVAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGMVQNPNIVNSIVALLSI SGLLIGSGFIRNIEEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSVPNNPM CSMTQGIQFIEKTCPGATSRFTTNFLILYSFIPTLVILGMVVFKVRDYLISR
Uniprot No.

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. This heterodimer plays a crucial role in the selective transport of dietary plant sterols and cholesterol into and out of enterocytes, and in the selective excretion of sterols by the liver into bile. It is essential for maintaining normal sterol homeostasis. The heterodimer with ABCG8 exhibits ATPase activity.
Gene References Into Functions
  1. Amino acid substitution in the sterol transport protein Abcg5 controls serum marinobufagenin levels in spontaneously hypertensive rats. PMID: 28982675
  2. Conversely, the significant reduction in hepatic Abcg5/8 observed is attributed to the high sugar content of the diets. PMID: 25912874
  3. A missense mutation in Abcg5 in hypertensive rats leads to the deposition of plant sterols in the body, but does not affect their biliary secretion or lymphatic absorption. PMID: 22484926
  4. Data indicate a significant reliance on an Abcg5/Abcg8-independent mechanism for basal biliary cholesterol secretion in rats during lactation, but a dependence on Abcg5/g8 for achieving maximal biliary cholesterol secretion. PMID: 20413720
  5. Mutation of Abcg5 in stroke-prone spontaneously hypertensive rats, compared to Wistar rats, did not influence the capacity for intestinal sitosterol absorption regardless of the dosage. PMID: 19966468
  6. Intestinal mRNA expression of Abcg5 (-47%) and Abcg8 (-43%), as well as Abcg5 protein content, are reduced in insulin-deficient animals. PMID: 14618236
  7. The previously identified Gly583Cys change in Abcg5 in three hypertension-susceptible rats is responsible for the sitosterolemia but may not be a major determinant of blood pressure in these rats. PMID: 16026620
  8. These findings suggest that a mutation in Abcg5 does not significantly influence intestinal absorption of plant sterols in SHRSP rats, at least when compared to Wistar rats. PMID: 19202267
Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver (at protein level). Expressed only in liver and intestine.

Q&A

What is ABCG5 and what is its function in rat models?

ABCG5 is an ATP-binding cassette half-transporter that functions in sterol trafficking. It forms a heterodimer with ABCG8, and mutations in either gene can cause sitosterolemia, an autosomal recessive disorder of sterol trafficking. In rodent models, ABCG5 plays a crucial role in limiting intestinal absorption and promoting biliary excretion of sterols. The protein is primarily expressed in the liver and intestine, where it regulates cholesterol and plant sterol homeostasis. When properly formed with ABCG8, this heterodimer functions at the apical (canalicular) membrane of polarized cells to efflux sterols into the intestinal lumen or bile .

What experimental approaches are used to study ABCG5 trafficking?

Researchers employ several complementary approaches to investigate ABCG5 trafficking:

  • Epitope tagging: Adding myc or HA epitope tags to the C-terminus of ABCG5 and ABCG8 allows for detection using monoclonal antibodies.

  • Pulse-chase experiments: Using [35S]-Met/Cys labeling to track protein synthesis and processing over time.

  • Glycosylation analysis: Treating protein samples with Endoglycosidase H (Endo H), PNGase F, or neuraminidase to determine the maturation state of N-linked glycans.

  • Cell fractionation: Separating cellular components to determine subcellular localization.

  • Immunoelectron microscopy: Directly visualizing protein localization at the ultrastructural level.

  • Polarized cell models: Using WIF-B cells to examine apical vs. basolateral targeting .

What are the established methods for generating recombinant rat ABCG5?

The generation of recombinant rat ABCG5 typically involves several steps:

  • cDNA cloning: The rat ABCG5 coding sequence is amplified from rat tissue RNA using reverse transcription PCR.

  • Epitope tagging: For detection purposes, epitope tags such as myc or HA are commonly added to the C-terminus using overlap PCR techniques.

  • Vector construction: The tagged cDNA is cloned into mammalian expression vectors such as pcDNA3.1(+) or similar plasmids.

  • Verification: The construct is verified by DNA sequencing to confirm correct sequence and reading frame.

  • Expression systems: Depending on the research question, different expression systems can be used:

    • Transient transfection in cell lines (e.g., CHO-K1, CRL-1601)

    • Stable cell line development using selection agents (e.g., G418, Zeocin)

    • Adenoviral vectors for efficient delivery to primary cells or difficult-to-transfect cell types .

What controls should be included when studying recombinant ABCG5?

When designing experiments with recombinant ABCG5, researchers should include these essential controls:

  • Individual expression controls: Expressing ABCG5 alone to compare with ABCG5+ABCG8 coexpression.

  • Glycosylation controls: Testing with various glycosidases (Endo H, PNGase F, neuraminidase) to confirm proper protein processing.

  • Localization controls: Including markers for relevant cellular compartments (ER, Golgi, plasma membrane).

  • Tagged vs. untagged proteins: Comparing behavior of tagged and untagged versions to ensure the tag doesn't interfere with function.

  • Negative controls: Empty vector transfection or β-galactosidase expressing constructs.

  • Wild-type vs. mutant: Including known disease-causing mutations as functional controls .

What are the key protocols for generating ABCG5 knockout rat models?

Recent advances in genome editing have facilitated the generation of ABCG5 knockout rat models. The CRISPR/Cas9 system has proven particularly effective:

  • Design strategy: Target sequences are selected in intronic regions to avoid off-target effects while ensuring complete gene disruption. For example, a successful approach involved using sgRNAs targeting one site in intron 4 of ABCG5 and another in intron 6 of ABCG8 to delete a 19kb region encompassing both genes.

  • sgRNA validation: The activity of selected sgRNAs should be evaluated using systems such as the Universal CRISPR Activity Assay (UCA).

  • Zygote injection: The CRISPR/Cas9 components are microinjected into rat zygotes.

  • Founder screening: PCR and sequencing are used to identify founders with the desired deletion.

  • Genotyping: Routine genotyping can be performed using PCR primers flanking the deletion site. For the ABCG5/ABCG8 double knockout, primers such as Forward: 5′-ctaggtccaccaagccatgtgaaca and Reverse: 5′-attttctgggcaccctgtgttccac have been successfully employed .

What phenotypes are observed in ABCG5 knockout rat models?

ABCG5 knockout rat models exhibit several distinct phenotypes:

PhenotypeHomozygous KnockoutHeterozygous KnockoutWild-type
HypercholesterolemiaSignificant elevationVariable/MildNormal
β-Sitosterol levelsSignificantly elevated (7 mg/dl)VariableNormal (2.5 mg/dl)
MacrothrombocytopeniaPresent in >80%Can occur in some animalsAbsent
Response to EzetimibeReduction in cholesterol and β-Sitosterol levels; improvement in platelet sizeImprovement in platelet size if affectedN/A

Importantly, the correlation between blood lipid alterations and macrothrombocytopenia is not strict, suggesting some phenotypic heterogeneity. The occurrence of large platelets even in some heterozygous animals indicates that certain ABCG5 variants may display dominant effects on platelet size .

How can researchers analyze ABCG5/ABCG8 heterodimerization?

Analyzing ABCG5/ABCG8 heterodimerization requires sophisticated biochemical approaches:

  • Co-immunoprecipitation: When ABCG5 and ABCG8 are tagged with different epitopes (e.g., myc and HA), immunoprecipitation with an antibody against one tag followed by immunoblotting with an antibody against the other tag can demonstrate physical association.

  • Glycosylation analysis: Monitoring the conversion from Endo H-sensitive to Endo H-resistant forms when both proteins are coexpressed provides indirect evidence of heterodimer formation.

  • Pulse-chase experiments: Tracking the appearance of higher molecular weight forms over time after coexpression can reveal the kinetics of heterodimer formation.

  • Subcellular fractionation: Demonstrating co-localization in non-ER fractions only when both proteins are expressed.

  • Blue native PAGE: This technique can be used to analyze intact protein complexes under non-denaturing conditions .

What are the methodological challenges in studying ABCG5 trafficking in polarized cells?

Studying ABCG5 trafficking in polarized cells presents several methodological challenges:

  • Cell model selection: Choosing appropriate polarized cell models that recapitulate the native environment. WIF-B cells have been successfully used as they form bile canalicular-like structures.

  • Expression system: Ensuring efficient delivery of both ABCG5 and ABCG8 constructs. Adenoviral vectors have proven effective for this purpose.

  • Apical marker selection: Identifying appropriate markers of the apical membrane (e.g., aminopeptidase N) for colocalization studies.

  • Visualization techniques: Implementing advanced microscopy methods that can resolve apical versus basolateral domains.

  • Transport studies: Developing functional assays to measure sterol transport across polarized monolayers .

How does ABCG5 function relate to platelet production and macrothrombocytopenia?

The relationship between ABCG5 function and platelet production represents an emerging area of research:

  • Identification of large platelets: Standard automated blood cell counting systems may not accurately detect macrothrombocytopenia, as they may not recognize large platelets. Manual counting using blood smears or specialized chambers is recommended.

  • Phenotypic heterogeneity: Large platelets have been observed in both homozygous and heterozygous carriers of certain ABCG5 variants, suggesting complex mechanisms.

  • Treatment approaches: Ezetimibe, which inhibits intestinal sterol absorption, has been shown to improve both hypercholesterolemia and macrothrombocytopenia in animal models and human subjects with ABCG5 variants.

  • Mechanistic studies: The exact pathway linking ABCG5 function to platelet size and production remains unclear and represents an important area for future research .

What are common pitfalls in ABCG5 expression studies and how can they be avoided?

Researchers studying ABCG5 expression should be aware of several potential pitfalls:

  • Expressing ABCG5 alone: When expressed individually, ABCG5 remains in the ER and doesn't reach the plasma membrane. Always coexpress with ABCG8 for functional studies.

  • Inadequate detection methods: The half-life of ABCG5 is approximately 3 hours, requiring sensitive detection methods for transient expression systems.

  • Glycosylation analysis interpretation: Multiple bands representing different glycosylation states can complicate interpretation. Always include appropriate glycosidase treatments as controls.

  • Protein aggregation: Overexpression can lead to aggregation. Titrate expression levels carefully.

  • Species differences: Be cautious when extrapolating between rat, mouse, and human ABCG5, as there may be species-specific differences in processing or function .

How can researchers distinguish between technical artifacts and true phenotypes in ABCG5 knockout models?

Distinguishing between technical artifacts and true phenotypes requires rigorous controls:

  • Multiple founder lines: Establish and compare at least two independent knockout lines to rule out off-target effects.

  • Heterozygote analysis: Include heterozygotes in all experiments as an internal control.

  • Rescue experiments: Reintroduce wild-type ABCG5 to verify that phenotypes can be reversed.

  • Tissue-specific knockouts: Generate tissue-specific knockouts to clarify the contribution of different organs to the observed phenotypes.

  • Complementary approaches: Validate knockout results with pharmacological inhibition or RNA interference .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.