Recombinant Rat ATP-dependent zinc metalloprotease YME1L1 (Yme1l1)

Shipped with Ice Packs
In Stock

Description

Introduction

YME1L1, or Yeast Mitochondrial Escape 1-Like 1, is an ATP-dependent metalloprotease that belongs to the AAA (ATPases Associated with diverse cellular Activities) family . Encoded by nuclear DNA, YME1L1 is found in the inner mitochondrial membrane, where its protease domain faces the intermembrane space . First identified in yeast, where it was found to influence the migration of mitochondrial DNA to the nucleus, YME1L1 is essential for mitochondrial maintenance . It participates in the assembly, turnover, and surveillance of mitochondrial proteins, all of which are critical for mitochondrial function .

Structure and Function

YME1L1 is imported into the mitochondria as a precursor protein of approximately 80 kDa . This import involves the mitochondrial processing peptidase (MPP), which cleaves the mitochondrial targeting sequence (MTS) to produce a mature protein of about 63 kDa . The mature form then assembles into a homo-oligomeric complex within the inner mitochondrial membrane .

YME1L1 acts as a protease, degrading proteins in both the intermembrane space and the inner mitochondrial membrane . Known substrates include lipid transfer proteins, components of protein translocases, and OPA1 (optic atrophy 1), a dynamin-like GTPase . By degrading these proteins, YME1L1 influences mitochondrial morphology, respiratory function, and cell survival . It ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity, and protects mitochondria .

Gene Information

Gene InformationDescription
Gene NameYME1 like 1 ATPase
AliasYME1L1
NCBI Gene ID10730
OrganismHomo sapiens (human)

Role in Disease

Mutations in the YME1L1 gene have been linked to mitochondriopathies, which are disorders affecting the mitochondria . These mutations can cause a range of symptoms, including developmental delays, muscle weakness, ataxia, and optic nerve atrophy .

One specific mutation, a homozygous missense mutation, inhibits the cleavage of YME1L1 by MPP, leading to rapid degradation of the YME1L1 precursor protein . The effects of impaired YME1L1 function include proliferation defects and mitochondrial network fragmentation, resulting from abnormal processing of OPA1 .

Functional Impairment

Studies involving a specific mutation (R149W) have demonstrated functional impairments of YME1L1 . This mutation affects the MPP processing site, impairing YME1L1 maturation and leading to its degradation . The YME1L1 R149W mutation also leads to a proliferation defect, abnormal OPA1 processing, and mitochondrial fragmentation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
Yme1l1; ATP-dependent zinc metalloprotease YME1L1; ATP-dependent metalloprotease FtsH1; Meg-4; YME1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Yme1l1
Target Protein Sequence
MFSLSSTVQPQVTVPLSHLINAFHSPKNISVSVNTSASPKQHRDTVAEHEAPSSEPVLNL RDLGLSELKIGQIDKLVENLLPGFYKDKRVSSCWHTSHISAQSFFENKYGHLDMFSTLRS SSLYRQHPKTLQSICSDLQNFPVFIQSRGFKTLKSRTRRLQSTSERLAEAQNIAPSFVKG FLLRDRGTDLESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILF VLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQELQEVVEFL KNPQKFTVLGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGAS RIRNLFREAKANAPCVIFIDELDSVGGKRIEFPMHPYSRQTIIQLLAEMDGFKPNEGVII IGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDKSVDPEIIARGT VGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAY HESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNEIRAQLLAQMDVSMGGR VAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIE QEIRILLRESYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKLEVR
Uniprot No.

Target Background

Function
Recombinant Rat ATP-dependent zinc metalloprotease YME1L1 (Yme1l1) is an ATP-dependent metalloprotease that catalyzes the degradation of folded and unfolded proteins possessing suitable degron sequences within the mitochondrial intermembrane region. It plays a crucial role in regulating mitochondrial morphology and function by cleaving OPA1 at position S2, generating an OPA1 form that supports the maintenance of normal mitochondrial structure. YME1L1 is essential for cell proliferation, maintaining normal cristae morphology and complex I respiration activity, promoting anti-apoptotic activity, and protecting mitochondria from the accumulation of oxidatively damaged membrane proteins. Furthermore, it is required for the normal, constitutive degradation of PRELID1 and catalyzes the degradation of OMA1 in response to membrane depolarization. YME1L1 is also necessary for controlling the accumulation of unassembled respiratory chain subunits (NDUFB6, OX4, and ND1).
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane. Mitochondrion.

Q&A

What is YME1L1 and what is its cellular localization?

YME1L1 (Yeast Mitochondrial Escape 1-Like 1) is a nuclear genome-encoded ATP-dependent metalloprotease that belongs to the AAA family of ATPases (ATPases associated with a variety of cell activities). It is embedded in the inner mitochondrial membrane with its protease domain facing the intermembrane space, classifying it as an i-AAA protease . YME1L1 was first identified in yeast during a screen for gene products that increase the rate of mitochondrial DNA migration to the nucleus .

In mammalian cells, YME1L1 forms a homo-oligomeric complex within the inner mitochondrial membrane after import and processing. Biochemical analyses show that YME1L1 primarily exists as an approximately 1 MDa oligomeric complex, with smaller populations of complexes between 242-720 kDa sometimes detectable under certain conditions .

What are the molecular characteristics of rat YME1L1?

YME1L1 has three isoforms produced by alternative splicing, with molecular weights of approximately 86 kDa, 80 kDa, and 76 kDa before processing . For recombinant expression, researchers typically work with the predominant isoform to ensure consistency in experimental results.

How is YME1L1 imported into mitochondria?

YME1L1 import into mitochondria follows the canonical pathway for nuclear-encoded mitochondrial proteins. The process involves:

  • Synthesis of YME1L1 precursor protein with an N-terminal mitochondrial targeting sequence (MTS)

  • Recognition of the MTS by the translocase of the outer membrane (TOM) complex

  • Translocation across the outer membrane through the TOM complex

  • Engagement with the translocase of the inner membrane (TIM) complex

  • Proteolytic processing by the mitochondrial processing peptidase (MPP), which cleaves off the MTS

  • Assembly into homo-oligomeric complexes within the inner membrane

Studies using in vitro import assays with radiolabeled YME1L1 precursor proteins have demonstrated that mutations in the MTS, such as the R149W mutation, can impair proper processing by MPP, leading to rapid degradation of the precursor protein and reduced YME1L1 function .

What are the primary functions of YME1L1 in mitochondria?

YME1L1 performs several critical functions in mitochondria:

  • Protein quality control: Degrades damaged or misfolded proteins in the intermembrane space and inner membrane

  • Mitochondrial dynamics regulation: Processes the dynamin-like GTPase OPA1, which is essential for mitochondrial fusion and cristae morphology

  • Respiratory chain maintenance: Controls the accumulation of respiratory chain subunits, particularly complex I components

  • Cell proliferation support: Ensures proper cell proliferation through maintaining mitochondrial function

  • Oxidative stress protection: Protects mitochondria from the accumulation of oxidatively damaged membrane proteins

  • Apoptosis regulation: Promotes antiapoptotic activity, potentially through maintenance of mitochondrial integrity

Loss of YME1L1 function results in impaired mitochondrial proteostasis, altered cristae morphology, compromised respiratory capacity, and increased susceptibility to oxidative stress .

How does YME1L1 regulate mitochondrial morphology?

YME1L1 plays a crucial role in maintaining mitochondrial morphology through its involvement in the processing of OPA1, a key regulator of mitochondrial fusion and cristae structure . The process involves:

  • YME1L1-mediated proteolytic processing of long OPA1 isoforms (L-OPA1) to generate short OPA1 isoforms (S-OPA1)

  • Balanced levels of L-OPA1 and S-OPA1 are required for proper mitochondrial fusion and cristae maintenance

  • YME1L1 dysfunction leads to abnormal OPA1 processing, resulting in fragmented mitochondrial networks

In cell culture studies, YME1L1-deficient cells display distinct morphological changes in mitochondria. For instance, patient-derived fibroblasts with YME1L1 mutations show increased proportions of shortened and fragmented mitochondrial networks compared to control cells . This phenotype can be quantified through blind categorization of mitochondrial morphology into four states: hyperfused, tubular, short tubules, and fragmented networks .

What substrates are processed by YME1L1?

YME1L1 processes several key mitochondrial proteins:

SubstrateLocalizationFunctionConsequence of YME1L1-mediated processing
OPA1Inner membraneMitochondrial fusion and cristae maintenanceGeneration of S-OPA1 forms required for proper fusion events
Tim17AInner membraneComponent of protein translocaseDegradation during stress conditions to regulate mitochondrial protein import
Lipid transfer proteinsIntermembrane spacePhospholipid metabolismRegulation of mitochondrial phospholipid homeostasis
Ndufb6Inner membraneComplex I subunitRegulation of respiratory chain assembly
ND1Inner membraneComplex I subunitRegulation of respiratory chain assembly
Cox4Inner membraneComplex IV subunitRegulation of respiratory chain assembly

YME1L1 substrate specificity is thought to be determined by recognition of specific sequence motifs and/or structural features, though the precise determinants remain under investigation.

How can recombinant rat YME1L1 be efficiently expressed and purified?

Expressing and purifying functional recombinant rat YME1L1 requires specific considerations due to its membrane protein nature and complex assembly. A recommended protocol includes:

  • Expression system selection:

    • Bacterial systems (E. coli): Use for expression of soluble domains (e.g., the catalytic domain)

    • Insect cell systems (Sf9, High Five): Preferred for full-length protein with proper folding

    • Mammalian cell systems (HEK293): Best for obtaining fully functional protein with native post-translational modifications

  • Construct design:

    • Remove the mitochondrial targeting sequence (first ~20-25 amino acids) to improve expression

    • Consider adding a cleavable N-terminal tag (His6 or GST) for purification

    • For membrane domain studies, add a C-terminal tag since the N-terminus may be processed

  • Purification strategy:

    • Solubilize membranes with mild detergents (DDM, CHAPS, or digitonin)

    • Use affinity chromatography (Ni-NTA for His-tagged proteins)

    • Apply size exclusion chromatography to isolate the ~1 MDa complex

    • Maintain ATP in buffers (1-2 mM) to stabilize the AAA domain structure

  • Activity verification:

    • Conduct ATP hydrolysis assays to confirm enzymatic activity

    • Perform proteolytic assays using known substrates like OPA1-derived peptides

    • Verify oligomeric state by Blue Native PAGE or analytical ultracentrifugation

Active recombinant YME1L1 typically requires the presence of ATP and divalent cations (Mg2+, Zn2+) for optimal function during experimental applications .

What methods are most effective for studying YME1L1 substrate specificity?

Several complementary approaches can be employed to investigate YME1L1 substrate specificity:

  • In vitro proteolysis assays:

    • Incubate purified recombinant YME1L1 with candidate substrate proteins or peptides

    • Include ATP (1 mM), Zn2+ (1 mM), and Mg2+ (5 mM) in reaction buffer

    • Analyze cleavage products by SDS-PAGE, western blotting, or mass spectrometry

    • Use inactive YME1L1 mutants (E543Q in the catalytic site) as negative controls

  • Cellular substrate trapping:

    • Express catalytically inactive YME1L1 (E543Q) in YME1L1-depleted cells

    • Perform co-immunoprecipitation to identify trapped substrates

    • Analyze by mass spectrometry to identify novel interacting proteins

  • Comparative proteomics:

    • Compare protein abundance in wild-type vs. YME1L1 knockout/knockdown models

    • Focus on inner membrane and intermembrane space proteins

    • Validate candidates using in vitro assays and co-immunoprecipitation

  • Substrate sequence analysis:

    • Analyze cleavage sites in known substrates to identify consensus motifs

    • Use peptide libraries to systematically test sequence preferences

    • Apply computational approaches to predict potential substrates based on identified motifs

When analyzing data, it's important to distinguish direct YME1L1 substrates from proteins affected indirectly through downstream effects of YME1L1 deficiency .

How does oxidative stress affect YME1L1 stability and function?

Oxidative stress significantly impacts YME1L1 stability and function through several mechanisms:

  • Decreased protein stability:

    • Hydrogen peroxide (H2O2) treatment accelerates YME1L1 degradation in cellular models

    • Cycloheximide chase experiments show significantly reduced YME1L1 half-life under oxidative stress conditions

    • The degradation involves OMA1, another stress-activated mitochondrial protease

  • Complex dissociation:

    • Oxidative stress promotes dissociation of the ~1 MDa YME1L1 complex

    • Blue Native PAGE analysis reveals increased populations of smaller YME1L1 complexes (242-720 kDa) following H2O2 treatment

    • This dissociation likely precedes degradation

  • ATP dependence:

    • YME1L1 stability is highly sensitive to ATP depletion

    • Combined treatment with 2-deoxyglucose (2-DG) and CCCP, which reduces ATP levels by >90%, decreases YME1L1 protein by up to 85%

    • ATP supplementation in isolated mitochondria can partially stabilize YME1L1

  • Functional consequences:

    • Reduced YME1L1 levels compromise stress-dependent degradation of substrates like Tim17A

    • This impairs the cell's capacity to regulate inner mitochondrial membrane proteostasis during stress

    • YME1L1-depleted cells show increased sensitivity to subsequent oxidative stress

These findings suggest a regulatory mechanism where oxidative stress triggers YME1L1 degradation, potentially to adapt mitochondrial function under stress conditions or to sequester damaged mitochondria for mitophagy .

What phenotypes result from YME1L1 dysfunction in cellular and animal models?

YME1L1 dysfunction produces distinct phenotypes across different model systems:

  • Cellular models (YME1L1 knockdown/knockout):

    • Impaired cell proliferation

    • Fragmented mitochondrial network

    • Altered cristae morphology

    • Diminished rotenone-sensitive respiration (Complex I)

    • Increased susceptibility to mitochondrial membrane protein carbonylation

    • Excessive accumulation of non-assembled respiratory chain subunits

    • Apoptotic resistance

    • Increased sensitivity to oxidative stress

  • Patient-derived cells (YME1L1 R149W mutation):

    • Increased proportions of short and fragmented mitochondria

    • Partial YME1L1 function retention (hypomorphic allele)

    • Abnormal OPA1 processing

  • Mouse models:

    • Complete YME1L1 knockout is embryonically lethal

    • Conditional tissue-specific knockouts show tissue-dependent phenotypes

    • Adult cardiac fibroblasts from Yme1l1-/- mice display mitochondrial fragmentation that can be rescued by wild-type but not R149W mutant human YME1L1

  • Human patients (YME1L1 mutations):

    • Infantile-onset developmental delay

    • Muscle weakness

    • Ataxia

    • Optic nerve atrophy

These phenotypes underscore the critical role of YME1L1 in mitochondrial function and cellular homeostasis, with particular importance in high-energy-consuming tissues like brain, muscle, and heart .

How can YME1L1 proteolytic activity be measured in experimental settings?

YME1L1 proteolytic activity can be measured using several experimental approaches:

  • In vitro proteolysis assays:

    • Purified recombinant YME1L1 + purified substrate protein

    • Buffer conditions: 20 mM HEPES (pH 7.4), 50 mM NaCl, 1 mM ZnCl2, 1 mM ATP, 5 mM MgCl2

    • Incubation at 30°C for defined time periods

    • Analysis by SDS-PAGE and western blotting or fluorescent substrate detection

  • Fluorescent peptide-based assays:

    • Synthetic peptides derived from known substrates with fluorophore/quencher pairs

    • Proteolytic cleavage results in fluorescence increase

    • Allows continuous real-time measurement of activity

    • Suitable for high-throughput inhibitor screening

  • Cellular substrate accumulation:

    • Monitor steady-state levels of known YME1L1 substrates (e.g., Tim17A, non-assembled respiratory chain subunits)

    • Compare wild-type vs. YME1L1-depleted or inhibited conditions

    • Quantify by western blotting with appropriate antibodies

  • OPA1 processing assay:

    • Monitor the ratio of long (L-OPA1) to short (S-OPA1) forms

    • YME1L1 activity correlates with specific S-OPA1 band generation

    • Distinguish from OMA1-dependent OPA1 processing using appropriate controls

    • Quantify band intensities using densitometry

  • Substrate degradation kinetics:

    • Pulse-chase experiments with radiolabeled substrates

    • Cycloheximide chase experiments to monitor substrate half-life

    • Compare degradation rates in control vs. YME1L1-manipulated conditions

When interpreting results, consider that YME1L1 activity is dependent on ATP levels, membrane potential, and can be affected by oxidative stress conditions .

What are common challenges in working with recombinant YME1L1 and how can they be addressed?

Researchers working with recombinant YME1L1 frequently encounter several challenges:

  • Low expression yields:

    • Solution: Optimize codon usage for expression system; use stronger promoters; test different tags; express without the mitochondrial targeting sequence; consider using fusion partners to improve solubility

    • Alternative approach: Express individual domains separately for domain-specific studies

  • Protein inactivity:

    • Solution: Ensure proper buffer conditions (include ATP, Zn2+, Mg2+); avoid freezing/thawing cycles; use gentle detergents; consider adding stabilizing agents like glycerol (10-20%)

    • Verification method: Always include positive controls with known activity in functional assays

  • Improper oligomerization:

    • Solution: Verify complex formation by Blue Native PAGE or size exclusion chromatography; optimize detergent type and concentration; ensure sufficient protein concentration for assembly

    • Analysis method: Compare with native YME1L1 complexes from mitochondrial extracts

  • Substrate specificity issues:

    • Solution: Use physiologically relevant substrates; ensure proper substrate folding; consider membrane environment effects

    • Control experiment: Include substrate specificity controls using known YME1L1 substrates like OPA1 or Tim17A

  • Distinguishing from other mitochondrial proteases:

    • Solution: Use specific inhibitors or generate catalytically inactive mutants (E543Q); perform experiments in YME1L1-knockout backgrounds

    • Validation approach: Compare with other i-AAA or m-AAA proteases to confirm specificity

How do YME1L1 mutations affect its function in experimental models?

Different YME1L1 mutations can produce varying effects on protein function, which is important to consider when designing experiments:

  • Catalytic site mutations (e.g., E543Q):

    • Eliminates proteolytic activity while maintaining ATP binding and substrate interaction

    • Useful for substrate-trapping experiments to identify interacting proteins

    • Does not affect protein stability or localization

    • Dominant-negative effect when expressed in wild-type background

  • ATP-binding site mutations (Walker A/B motifs):

    • Prevents ATP hydrolysis, which is required for substrate translocation and processing

    • May destabilize the oligomeric complex

    • Useful for distinguishing ATP-dependent from ATP-independent functions

  • Mitochondrial targeting sequence mutations (e.g., R149W):

    • Inhibits proper processing by mitochondrial processing peptidase

    • Results in rapid degradation of the precursor protein

    • Leads to hypomorphic phenotype with residual YME1L1 function

    • Found in patients with mitochondriopathy

  • Oligomerization domain mutations:

    • Disrupts formation of the ~1 MDa complex

    • Results in smaller complexes with reduced activity

    • May mimic the effects of oxidative stress on complex stability

When using these mutations in experimental models, it's important to verify protein expression, localization, and complex formation to properly interpret functional outcomes. The R149W mutation provides a valuable model for studying partial loss of function, while complete knockout models show more severe phenotypes .

What controls should be included when studying YME1L1 in experimental settings?

Proper experimental controls are essential when studying YME1L1:

  • For YME1L1 knockdown/knockout experiments:

    • Positive control: Wild-type cells or tissues with normal YME1L1 expression

    • Rescue control: Re-expression of wild-type YME1L1 in knockout background

    • Specificity control: Monitor other mitochondrial proteases (e.g., AFG3L2) to confirm specific effects

    • Functional control: Measure known YME1L1-dependent processes (e.g., OPA1 processing)

  • For in vitro activity assays:

    • Negative control: Catalytically inactive YME1L1 (E543Q)

    • ATP dependence control: Reactions with and without ATP

    • Substrate specificity control: Non-substrate proteins or peptides

    • Buffer control: Ensure optimal conditions (pH, ion concentrations)

  • For stress response studies:

    • Mitochondrial membrane potential control: Monitor alongside YME1L1 levels

    • ATP level control: Measure cellular ATP concurrently with YME1L1 function

    • OMA1 activation control: Monitor OPA1 processing as indicator

    • Oxidative damage control: Measure protein carbonylation or other oxidative damage markers

  • For mitochondrial morphology analysis:

    • Blind quantification: Categorize mitochondrial morphology without knowledge of sample identity

    • Multiple markers: Use different mitochondrial markers (e.g., TOMM20, mito-GFP)

    • Multiple cell types: Test effects in different cell types where possible

    • Complementation control: Express wild-type and mutant YME1L1 in knockout cells

Including these controls helps ensure experimental rigor and enables proper interpretation of YME1L1-specific effects versus secondary consequences or technical artifacts.

What are emerging areas of YME1L1 research with therapeutic potential?

Several promising research directions for YME1L1 have therapeutic implications:

  • Neuroprotective strategies:

    • YME1L1 dysfunction is linked to optic nerve atrophy and neurological symptoms

    • Enhancing YME1L1 stability during oxidative stress may protect neurons

    • Potential applications in neurodegenerative diseases with mitochondrial dysfunction

  • Metabolic disease interventions:

    • YME1L1 regulates respiratory chain components and energy production

    • Modulating YME1L1 activity could improve mitochondrial function in metabolic disorders

    • Target for conditions with impaired mitochondrial dynamics

  • Cancer metabolism targeting:

    • Cancer cells often exhibit altered mitochondrial dynamics and function

    • YME1L1 ensures cell proliferation

    • Inhibiting YME1L1 could selectively target cancer cells dependent on specific mitochondrial states

  • Stress response modulation:

    • YME1L1 degradation during stress may be protective or pathological

    • Preventing excessive YME1L1 degradation could maintain mitochondrial proteostasis

    • Potential applications in ischemia-reperfusion injury or other acute stress conditions

  • Mitochondrial quality control enhancement:

    • YME1L1 protects against accumulation of oxidatively damaged proteins

    • Boosting this function could improve cellular resilience to oxidative stress

    • Relevant for aging-related conditions with mitochondrial dysfunction

Research focusing on these areas will benefit from developing specific modulators of YME1L1 activity, better understanding its substrate specificity, and characterizing its regulatory mechanisms in different tissues and disease states.

How might advanced techniques advance our understanding of YME1L1 function?

Cutting-edge techniques are poised to reveal new insights about YME1L1:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of YME1L1 complexes

    • Visualize substrate engagement and translocation mechanisms

    • Identify structural changes during ATP hydrolysis cycle

  • Proximity labeling proteomics (BioID, APEX):

    • Map the local interactome of YME1L1 in the inner membrane

    • Identify transient substrates and interaction partners

    • Differentiate spatial organization in different mitochondrial subcompartments

  • Single-molecule techniques:

    • Observe real-time substrate processing by individual YME1L1 complexes

    • Determine processivity and mechanisms of substrate unfolding

    • Characterize force generation during substrate translocation

  • Organoid and tissue-specific models:

    • Study YME1L1 function in physiologically relevant 3D tissue models

    • Investigate tissue-specific phenotypes and substrate preferences

    • Test potential therapeutic interventions in complex cellular environments

  • Multi-omics integration:

    • Combine proteomics, metabolomics, and transcriptomics data

    • Map the system-wide effects of YME1L1 dysfunction

    • Identify compensatory mechanisms and regulatory networks

  • In vivo biosensors:

    • Develop reporters for YME1L1 activity in living cells

    • Monitor real-time changes in YME1L1 function during stress responses

    • Screen for compounds that modulate YME1L1 stability or activity

These approaches will help advance our understanding of YME1L1 beyond its basic biochemical functions to its integrated roles in cellular physiology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.