Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Kcnj10 encodes Kir4.1, an ATP-sensitive inwardly rectifying potassium channel that facilitates potassium ion flow into cells more efficiently than outward flow. Key features include:

  • Structure: Tetrameric assembly with transmembrane (TM1, TM2) and pore-forming (H5) domains .

  • Function:

    • Maintains glial potassium buffering in the brain .

    • Regulates basolateral K⁺ recycling in renal distal tubules, critical for sodium reabsorption .

    • Modulates endolymph production in the inner ear .

Pathological Relevance:

  • Mutations cause EAST syndrome (Epilepsy, Ataxia, Sensorineural deafness, Tubulopathy) .

  • Gain-of-function variants (e.g., p.R18Q) are linked to autism-epilepsy comorbidity .

3.1. Neurological Studies

  • Epilepsy and Autism: Gain-of-function mutations (e.g., p.R18Q) enhance Kir4.1 membrane expression, disrupting synaptic transmission and promoting seizures .

  • Glial Function: Recombinant Kir4.1 is used to model potassium buffering defects in astrocytes, which impair neuronal excitability .

3.2. Renal Physiology

  • Knockout mouse models (global Kir4.1⁻/⁻) exhibit hypokalemia and metabolic alkalosis, mimicking EAST syndrome .

  • In distal convoluted tubules, Kir4.1 mediates basolateral K⁺ recycling, essential for Na⁺-Cl⁻ cotransporter (NCC) activity .

3.3. Auditory Research

  • Kir4.1 is critical for generating the endocochlear potential in the stria vascularis. Dysfunction leads to sensorineural deafness .

Product Validation and Quality Control

  • Western Blot: Detects a ~250 kDa band in rat brain lysates, consistent with tetrameric assembly .

  • Selectivity: No cross-reactivity with Kir1.1 (KCNJ1) or Kir4.2 (KCNJ15) .

  • Functional Assays: Electrophysiology confirms ATP sensitivity and inward rectification .

Challenges and Future Directions

  • Limitations: Recombinant Kir4.1 lacks post-translational modifications present in native tissues .

  • Emerging Tools: Transgenic Tg(Kcnj10-ZsGreen) mice enable real-time visualization of Kir4.1-expressing cells .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is Tris/PBS-based buffer with 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-379aa
Mol. Weight
48.5 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Rattus norvegicus (Rat)
Target Names
Kcnj10
Target Protein Sequence
MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
ATP-sensitive inward rectifier potassium channel 10 (Kcnj10), also known as Kir4.1, is a potassium channel that plays a critical role in potassium buffering in glial cells, particularly in the brain. Inward rectifier potassium channels exhibit a stronger tendency to allow potassium to flow into the cell rather than out. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium levels increase, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is primarily attributed to the blockage of outward current by internal magnesium. The channel can be blocked by extracellular barium and cesium. In the kidney, Kir4.1, in conjunction with KCNJ16, mediates basolateral K+ recycling in distal tubules, a process crucial for Na+ reabsorption in these tubules.
Gene References Into Functions
  1. H3K9me2 and G9a, enzymes involved in histone methylation, are sensitive to epileptic seizure activity during the acute phase of epilepsy. These enzymes can influence the transcriptional regulation of the Kcnj10 (Kir4.1) channel. PMID: 29115470
  2. Research suggests that advanced glycation end products (AGEs) modification of laminin has detrimental effects on Kir4.1 channels. Studies investigating the role of AGEs in Kir4.1 channels have identified a novel mechanism for Muller cell dysfunction and its subsequent involvement in diabetic retinopathy. PMID: 29474462
  3. Interleukin-1beta (IL-1beta) promotes the proliferation of cultured astrocytes by influencing the expression of Kir4.1. PMID: 28395711
  4. Kir4.1 channels exhibit a diurnal rhythm, which is dampened in individuals with diabetes, suggesting that increased levels of tumor necrosis factor-alpha (TNF-alpha) are detrimental to the normal rhythm and expression of Kir4.1. PMID: 28460049
  5. This study demonstrated changes in Kir4.1 expression in an animal model of periventricular leukomalacia (PVL) during both the acute and chronic stages of the condition. PMID: 26768400
  6. This study highlighted the developmental expression of Kir4.1 in both the cortex and hippocampus and provided support for the role of Kir4.1 in potassium spatial buffering by glial cells. PMID: 26427731
  7. Data suggest that the G83V, L166Q, and Q212R residues within Kir4.1 play a crucial role in regulating channel function. PMID: 26867573
  8. Findings suggest that lipopolysaccharide (LPS)-induced downregulation of Kir4.1 mRNA in cultured astrocytes may be related to the inflammatory cytokine IL-1beta. PMID: 26927380
  9. Excessive activation of NMDA receptors is a primary cause of the reduction in Kir4.1 expression in central nervous system (CNS) disorders associated with increased glutamate exposure. PMID: 25451797
  10. Ependymal cells and tanycytes utilize distinct mechanisms involving Kir4.1 and aquaporin 4 (AQP4) to regulate fluid properties in specific brain regions. PMID: 25380566
  11. This study demonstrated the epigenetic regulation of Kir4.1, a glial-specific potassium channel, known to be essential for normal CNS development. PMID: 24415225
  12. The results suggest that reduced activity of astrocytic Kir4.1 channels in the amygdala contributes to limbic hyperexcitability in individuals with narcolepsy with cataplexy. PMID: 23603404
  13. Decreased expression of Kir4.1 is observed in the brainstem and cortex of rats in an amyotrophic lateral sclerosis model. PMID: 22987392
  14. An uncoupling of AQP4 and Kir4.1 expression on astrocytic end feet is partly responsible for mediating cytotoxic edema following subarachnoid hemorrhage. PMID: 22420318
  15. Kir4.1 channels in satellite glial cells are suppressed during trigeminal inflammatory pain. PMID: 21680091
  16. Pigment epithelium-derived factor acts as an antioxidative agent against the decrease in Kir4.1 expression in retinal Muller cells under diabetic conditions. PMID: 22266516
  17. Down-regulation of Kir4.1 may mediate distinct aspects of glutamine-induced astrocytic dysfunction in hepatic encephalopathy. PMID: 21538466
  18. Astrocytes in the CA1 region of the hippocampus experience progressive depolarization following cerebral ischemia, coinciding with decreased Kir4.1 protein expression in glial cells. PMID: 20833221
  19. Heteromeric Kir4.1-Kir5.1 channels confer pH sensitivity to retrotrapezoid nucleus astrocytes. PMID: 20926613
  20. Data indicate that all Kir4.1 mutations compromise channel function, but the underlying mechanisms vary. PMID: 20807765
  21. Calcium-sensing receptor (CaR) decreases cell surface expression of Kir4.1 channels through a mechanism involving Galpha(q) and caveolin. PMID: 21084311
  22. These results suggest the differential loss of KIR4.1 channel function among mutations associated with SeSAME syndrome. PMID: 20678478
  23. In adult rats, Kir4.1 expression is reduced by nearly 80% following crush spinal cord injury. PMID: 20375134
  24. Data suggest that signals on the COOH terminus of the Kir4.1 potassium channel determine the intracellular localization of the Kir5.1 potassium channel/Kir4.1 heteromer in distal tubules PMID: 15292049
  25. Results demonstrate that variations (T262S and R271C) in the gene encoding Kir4.1 do not produce any observable changes in channel function or in predicted channel structure. PMID: 15936844
  26. Disruption of the carboxyl-terminal PDZ-binding motif induced mostly clustered distribution but did not reduce whole-cell channel activity PMID: 16033858
  27. Kir4.1 channels are primarily responsible for significant hyperpolarization of cortical astrocytes and are likely to play a major role in potassium buffering. Significant inhibition of glutamate clearance in astrocytes with knock-down of Kir4.1 occurs. PMID: 17091490
  28. Modulation of the Kcnj10 channel by multiple neurotransmitters via Galphaq-coupled receptors is reported. PMID: 17559083
  29. Regional differences in astrocytic expression of Kir4.1 channels result in marked changes in potassium clearance rates in these two regions of the spinal cord. PMID: 17581847
  30. While confirming similar properties of glial Kir and recombinant Kir4.1, the results also suggest mechanisms underlying potassium buffering in glial cells. PMID: 18293411
  31. These results demonstrate that the phosphorylation-dependent scaffolding of the basolateral potassium channels by MAGI-1a-long participates in the renal regulation of fluid and electrolyte homeostasis. PMID: 18303016
  32. Silencing Kir4.1 in the trigeminal ganglion using RNA interference (RNAi) results in a reversible change in nociceptive threshold and nociceptive-related behavior. PMID: 18417695

Show More

Hide All

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Basolateral cell membrane.
Tissue Specificity
Predominantly expressed in the brain, including in glial cells of the cerebellum and forebrain. Expressed at lower levels in the kidney, and other peripheral tissues.

Q&A

What is KCNJ10 and what are its key physiological functions?

KCNJ10, also known as Kir4.1, is an ATP-sensitive inward rectifier potassium channel characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. This channel belongs to the inwardly-rectifying potassium channel family and plays crucial roles in multiple physiological processes .

In the brain, KCNJ10 is primarily expressed in glial cells where it is responsible for potassium buffering. When neuronal excitation occurs repeatedly, there is considerable potassium efflux leading to extracellular potassium buildup. KCNJ10 in glial cells takes up this excess extracellular potassium and distributes it through gap junctions, a process known as potassium "siphoning." This process is essential for preventing excessive neuronal excitability and reducing the risk of seizure activity .

In the inner ear, KCNJ10 is expressed in the intermediate cells of the stria vascularis, where it contributes to maintaining the rich potassium content of the endolymph. This function is imperative for the hearing mechanism as it facilitates potassium entry into cochlear hair cells needed for signal transduction .

In the kidney, KCNJ10 is localized to the basolateral membrane of distal convoluted tubules, connecting tubules, and cortical collecting ducts, where it participates in salt reabsorption .

What expression systems are most effective for studying recombinant rat KCNJ10?

For functional studies of recombinant rat KCNJ10, several expression systems have proven effective, each with specific advantages for different research questions:

  • Xenopus oocytes: This system is particularly valuable for electrophysiological studies and has been successfully used to characterize KCNJ10 mutations and channel properties. The large size of oocytes facilitates two-electrode voltage clamping for measuring whole-cell K+ currents .

  • Mammalian cell lines: CHO and HEK293 cells are commonly used for expressing KCNJ10 when studying channel function in a mammalian environment. These systems are particularly useful for assessing the impact of mutations on channel activity .

When selecting an expression system, researchers should consider whether to study KCNJ10 alone or co-express it with KCNJ16, as native renal KCNJ10 often forms heteromers with KCNJ16. Studies have shown that the functional consequences of some KCNJ10 mutations may only become fully apparent when co-expressed with KCNJ16 .

What methods can be used to measure KCNJ10 protein levels in experimental samples?

Several validated methods are available for measuring KCNJ10 protein levels in experimental samples:

  • ELISA (Enzyme-Linked Immunosorbent Assay): Sandwich ELISA kits specifically designed for rat KCNJ10 provide a highly sensitive method for quantifying KCNJ10 in serum, plasma, and cell lysate samples. These assays offer high specificity and reproducibility, with reported intra-assay CVs of approximately 3.8% and inter-assay CVs of 5.9% .

  • Western blotting: This technique is widely used for analyzing KCNJ10 expression in various experimental conditions. When performing Western blotting for KCNJ10, it's important to include appropriate controls and optimize antibody concentrations .

  • Immunohistochemistry/Immunofluorescence: These methods allow visualization of KCNJ10 localization within tissues and cells. They are particularly useful for confirming the basolateral membrane localization of KCNJ10 in kidney tubules and for examining changes in localization due to mutations or experimental conditions .

For all these methods, antibody selection is crucial. Researchers should validate antibodies for specificity using appropriate controls, including tissues from Kcnj10 knockout mice when available.

How do KCNJ10 mutations affect channel function and what are the best methods to characterize these effects?

KCNJ10 mutations associated with EAST syndrome (epilepsy, ataxia, sensorineural deafness, and tubulopathy) cause varying degrees of functional impairment, which can be characterized using several complementary approaches:

  • Whole-cell electrophysiology: Two-electrode voltage clamping in Xenopus oocytes expressing mutant KCNJ10 has revealed that mutations such as p.F75C, p.A167V, p.V91fs197X, R65P, G77R, and R175Q significantly reduce inwardly rectified currents compared to wild-type channels. The R199X mutation has been shown to cause complete loss of function .

  • Single-channel analysis: This technique has demonstrated that KCNJ10 mutations can lead to a strongly reduced mean open time, affecting channel kinetics at the molecular level .

  • pH sensitivity testing: The functional impact of some mutations (e.g., R65P and R175Q) is primarily due to a remarkable shift in pH sensitivity to the alkaline range. Therefore, testing channel function at different pH values is essential for fully characterizing certain mutations .

  • Co-expression with KCNJ16: Some mutations like p.A167V show significant residual function when expressed alone but exhibit almost complete loss of function when co-expressed with KCNJ16. This finding highlights the importance of testing mutations in heteromeric channels that better represent physiological conditions .

  • Expression analysis: Western blotting should be used to confirm that reduced current is due to functional defects rather than reduced protein expression .

The following table summarizes the functional characteristics of known KCNJ10 mutations:

MutationFunctional Impact AloneImpact with KCNJ16 Co-expressionMechanism of Dysfunction
R65PMarked impairmentDominant KCNJ10 dysfunctionShifted pH sensitivity
G77RMarked impairmentDominant KCNJ10 dysfunctionReduced channel activity
p.F75CSignificant reductionRequires testingReduced channel activity
p.A167VModerate reductionAlmost complete lossHeteromer sensitivity
R175QMarked impairmentDominant KCNJ10 dysfunctionShifted pH sensitivity
R199XComplete lossComplete lossTruncated protein
p.V91fs197XSignificant reductionRequires testingFrameshift mutation

What is the relationship between KCNJ10 and KCNJ16 and how does this impact experimental design?

The functional relationship between KCNJ10 and KCNJ16 is a critical consideration for experimental design in KCNJ10 research:

  • Co-localization evidence: Immunohistochemical studies in mouse kidney have shown that Kcnj10 and Kcnj16 are co-localized in the basolateral membrane of distal convoluted tubules, connecting tubules, and cortical collecting ducts. This suggests they likely form heteromeric channels in these tissues .

  • Heteromer formation: KCNJ10 and KCNJ16 can form heteromeric channels with properties distinct from homomeric channels. This heteromerization affects channel function, regulation, and pharmacology .

  • Differential mutation sensitivity: The pathogenicity of certain KCNJ10 mutations may only become apparent when co-expressed with KCNJ16. For example, the p.A167V mutation retains significant function when expressed alone but shows almost complete loss of function when co-expressed with KCNJ16 .

For robust experimental design, researchers should:

  • Include KCNJ16 co-expression conditions when studying KCNJ10 function, particularly for mutations of uncertain significance

  • Compare results from both homomeric and heteromeric channel studies

  • Consider tissue-specific expression patterns of KCNJ16 when interpreting results

  • Use appropriate controls to confirm heteromer formation when claimed

The evidence suggests that in vitro ascertainment of KCNJ10 function may necessitate co-expression with KCNJ16 to accurately reflect the physiological context and properly assess pathogenicity of mutations .

How can researchers effectively model KCNJ10-related pathologies?

Effective modeling of KCNJ10-related pathologies requires a multi-faceted approach:

  • Cellular models:

    • Heterologous expression systems (Xenopus oocytes, CHO cells, HEK293 cells) can be used to study the functional consequences of KCNJ10 mutations on channel properties .

    • Primary cultures of astrocytes, renal epithelial cells, or cochlear cells from wild-type and KCNJ10 knockout mice provide more physiologically relevant contexts for studying tissue-specific functions.

  • Animal models:

    • Kcnj10 knockout mice show severe phenotypes including hearing loss, making them valuable models for studying EAST syndrome features .

    • Knock-in models carrying specific KCNJ10 mutations found in human patients would allow for more accurate modeling of the disease.

  • Patient-derived models:

    • Electron microscopy of distal tubular cells from patients with EAST syndrome has revealed reduced basal infoldings in the nephron segment, reflecting the morphological consequences of impaired salt reabsorption capacity. These changes provide a cellular phenotype that can be used to validate model systems .

  • Tissue-specific considerations:

    • Brain: Focus on glial cells and their potassium buffering capacity, which can be assessed using potassium-sensitive microelectrodes in brain slices.

    • Inner ear: Examine the stria vascularis and measure endolymphatic potassium concentrations.

    • Kidney: Assess distal tubular function and morphology, focusing on salt reabsorption and basolateral membrane structure.

  • Phenotype correlation:

    • Comprehensive phenotyping should include electrophysiological measures, hearing tests, neurological assessment, and renal function tests.

    • pH sensitivity testing is particularly important as some mutations (e.g., R65P) show reduced function that improves under alkaline conditions, which may explain why metabolic alkalosis in patients potentially compensates for channel dysfunction .

What role does pH play in KCNJ10 function and how should this be considered in experimental protocols?

pH regulation of KCNJ10 function is a critical factor that significantly impacts channel activity and should be carefully considered in experimental protocols:

  • Differential pH sensitivity of mutations: Research has demonstrated that some KCNJ10 mutations (particularly R65P and R175Q) cause functional impairment primarily through a remarkable shift in pH sensitivity to the alkaline range. This means that the channel may show near-normal function at higher pH values but significantly reduced function at physiological pH .

  • Clinical relevance of pH effects: Patients with EAST syndrome carrying the R65P mutation often develop metabolic alkalosis, which may actually improve residual KCNJ10 function due to the shifted pH sensitivity of the mutant channel. This represents a potential compensatory mechanism that should be considered when interpreting clinical data .

  • Experimental recommendations:

    • Include a range of pH conditions (typically pH 6.0-8.0) when characterizing KCNJ10 channel function

    • For mutant channels, conduct detailed pH-response curves to identify shifts in pH sensitivity

    • Control and monitor pH carefully in all functional assays

    • Consider the interaction between pH and other regulatory factors (ATP, phosphorylation, etc.)

    • For in vivo studies, measure and report systemic pH as it may influence channel function

  • Technical considerations:

    • Buffer selection is critical for maintaining stable pH during experiments

    • Temperature affects pH of many buffers and should be controlled

    • Cell metabolism can alter local pH in some expression systems

    • Intracellular vs. extracellular pH effects may differ and should be distinguished when possible

Including pH as a controlled variable in KCNJ10 research protocols provides critical insights into channel regulation and may explain seemingly contradictory results between different experimental systems.

What are the best practices for detecting and quantifying KCNJ10 expression in tissue samples?

Optimizing detection and quantification of KCNJ10 in tissue samples requires careful attention to several methodological aspects:

  • Tissue preparation:

    • For immunohistochemistry: Use either fresh-frozen sections or properly fixed paraffin-embedded tissues. For KCNJ10, 4% paraformaldehyde fixation for 24 hours has been shown to preserve antigenicity while maintaining tissue architecture.

    • For protein extraction: Rapid tissue isolation and flash-freezing in liquid nitrogen help prevent protein degradation. Membrane protein extraction buffers containing non-ionic detergents are recommended for KCNJ10 isolation.

  • Antibody selection:

    • Validate antibodies using positive controls (tissues known to express KCNJ10) and negative controls (tissues from Kcnj10 knockout mice).

    • For rat KCNJ10, select antibodies that have been specifically validated for rat species to avoid cross-reactivity issues.

    • Consider using antibodies against different epitopes to confirm results.

  • Quantitative methods:

    • ELISA: Sandwich ELISA kits for rat KCNJ10 offer high sensitivity with detection ranges appropriate for physiological samples. These kits demonstrate good reproducibility with intra-assay CVs of approximately 3.8% and inter-assay CVs of around 5.9% .

    • Western blotting: Use quantitative Western blotting with appropriate loading controls and standard curves when possible. Image analysis software can help ensure quantification is performed within the linear range of detection.

    • qPCR: While measuring mRNA does not always correlate with protein levels, it provides complementary data on gene expression.

  • Localization studies:

    • Confocal microscopy with co-staining for membrane markers helps confirm the basolateral localization of KCNJ10 in kidney tubules.

    • Cell type-specific markers should be used to identify KCNJ10 expression in heterogeneous tissues like brain (glial markers) or kidney (tubule segment markers).

  • Advanced techniques:

    • Proximity ligation assay can be used to detect and quantify interactions between KCNJ10 and KCNJ16.

    • Electron microscopy immunogold labeling provides ultra-structural localization of KCNJ10, which is particularly useful for examining changes in basal infoldings in distal tubular cells .

What techniques can be used to study KCNJ10 channel kinetics and electrophysiological properties?

Several sophisticated techniques can be employed to characterize KCNJ10 channel kinetics and electrophysiological properties:

How can researchers effectively study the interaction between KCNJ10 mutations and disease phenotypes?

Establishing clear connections between KCNJ10 mutations and disease phenotypes requires an integrated research approach:

  • Genotype-phenotype correlation studies:

    • Comprehensive clinical assessment of patients with confirmed KCNJ10 mutations, focusing on the four cardinal features of EAST syndrome: epilepsy, ataxia, sensorineural deafness, and tubulopathy.

    • Detailed neuropsychological assessments should be included, as most patients with KCNJ10 mutations require special support in school .

    • Electroretinographic recordings should be considered as abnormalities have been reported in EAST patients .

  • Functional characterization of mutations:

    • Electrophysiological studies comparing wild-type and mutant channels under controlled conditions.

    • Examination of channel activity in both homomeric and heteromeric (with KCNJ16) configurations .

    • Assessment of protein expression, membrane trafficking, and subcellular localization.

  • Tissue-specific effects:

    • Brain: Evaluate glial potassium buffering capacity and neuronal excitability.

    • Inner ear: Examine endolymphatic potassium content and auditory function.

    • Kidney: Assess salt handling in distal tubules and morphological changes such as reduced basal infoldings .

  • Compensatory mechanisms:

    • Investigate whether metabolic alkalosis in patients with certain mutations (e.g., R65P) represents a compensatory mechanism that improves residual channel function at alkaline pH .

    • Examine potential compensatory roles of other potassium channels or transport mechanisms.

  • Model systems:

    • Use multiple model systems (cells, tissues, animals) to validate findings.

    • Consider generating knock-in animal models expressing specific human mutations.

    • Patient-derived cells or induced pluripotent stem cells differentiated into relevant cell types can provide physiologically relevant contexts.

  • Therapeutic implications:

    • Test whether manipulating pH or other regulatory factors can improve channel function in specific mutations.

    • Evaluate the effects of existing anti-epileptic or kidney-directed therapies on KCNJ10 function.

This integrated approach allows researchers to connect molecular dysfunction to cellular, tissue, and organismal pathology, providing insights into disease mechanisms and potential therapeutic targets.

What are the common pitfalls in KCNJ10 research and how can they be avoided?

Several technical challenges commonly arise in KCNJ10 research, but they can be addressed with appropriate methodological approaches:

  • Expression system limitations:

    • Pitfall: Heterologous expression systems may not recapitulate the cellular environment of native tissues.

    • Solution: Include multiple expression systems in your experimental design and validate key findings in primary cells or tissue slices when possible. Consider the co-expression of additional proteins known to interact with KCNJ10 in native settings, particularly KCNJ16 .

  • Antibody specificity issues:

    • Pitfall: Many commercially available antibodies show cross-reactivity with related potassium channels.

    • Solution: Validate antibodies using positive and negative controls, including tissues from Kcnj10 knockout mice. Consider using multiple antibodies targeting different epitopes and confirming results with alternative detection methods.

  • pH regulation challenges:

    • Pitfall: Failure to control pH can lead to inconsistent results, particularly when studying mutations with altered pH sensitivity.

    • Solution: Rigorously control and report pH in all functional studies. Include pH response curves as part of mutation characterization protocols .

  • Heteromeric channel complexity:

    • Pitfall: Studies of KCNJ10 alone may not reflect native channel configurations where heteromers with KCNJ16 predominate.

    • Solution: Include conditions with KCNJ10/KCNJ16 co-expression and compare results to homomeric channels. Use approaches that can confirm successful formation of heteromeric channels .

  • Translating in vitro findings to in vivo significance:

    • Pitfall: Channel dysfunction observed in vitro may not directly correlate with disease severity.

    • Solution: Correlate functional deficits with clinical phenotypes in patients with known mutations. Consider the potential for compensatory mechanisms, such as the metabolic alkalosis observed in patients with the R65P mutation .

  • Technical variability in electrophysiology:

    • Pitfall: Experimental conditions can significantly affect channel properties measured by electrophysiology.

    • Solution: Standardize protocols, include appropriate controls in each experiment, and report detailed methodological parameters to enable reproducibility. Consider using automated patch clamp for higher throughput and standardization when appropriate.

How can researchers optimize KCNJ10 protein production for functional studies?

Optimizing recombinant rat KCNJ10 protein production requires attention to several critical factors:

  • Expression vector selection:

    • Use vectors with strong promoters appropriate for your expression system (e.g., CMV for mammalian cells, T7 for in vitro transcription systems).

    • Consider vectors with sequence verification features and appropriate selection markers.

    • For mammalian expression, vectors with elements enhancing mRNA stability can improve protein yield.

  • Protein tagging strategies:

    • C-terminal tags are generally preferred for KCNJ10 as N-terminal modifications may interfere with channel function.

    • Common affinity tags include His, GST, DDK, Myc, SUMO, and Fc tags, each with different advantages for purification and detection .

    • Fluorescent protein fusions (e.g., GFP) can be useful for trafficking studies but may affect channel function and should be validated.

  • Expression system optimization:

    • For Xenopus oocytes: Optimize cRNA quality, concentration (typically 5-50 ng), and injection volume. Allow 24-72 hours for expression before recording .

    • For mammalian cells (HEK293, CHO): Optimize transfection conditions, cell density, and expression time. Consider stable cell lines for consistent expression .

    • For cell-free systems: Wheat germ extracts have been used successfully for KCNJ10 expression .

  • Co-expression considerations:

    • When co-expressing KCNJ10 with KCNJ16, optimize the ratio of constructs to ensure proper heteromer formation.

    • Include appropriate controls to confirm heteromer assembly.

  • Protein purification strategies:

    • Membrane proteins like KCNJ10 require carefully optimized solubilization conditions.

    • Detergent selection is critical: mild non-ionic detergents (e.g., DDM, LMNG) often work well for maintaining KCNJ10 structure and function.

    • Consider native purification methods to maintain protein-protein interactions when studying complexes.

  • Quality control measures:

    • Verify protein expression and integrity by Western blotting before functional studies.

    • Assess membrane localization using surface biotinylation or confocal microscopy.

    • For purified protein, techniques such as size exclusion chromatography can confirm proper oligomeric state.

  • Storage considerations:

    • For purified protein, optimize buffer conditions to maintain stability.

    • Aliquot samples to avoid freeze-thaw cycles.

    • Consider cryoprotectants if freeze-thaw cannot be avoided.

By optimizing these aspects of protein production, researchers can ensure sufficient yield of functional KCNJ10 for their experimental needs.

What emerging technologies might advance KCNJ10 research?

Several cutting-edge technologies show promise for advancing our understanding of KCNJ10 function and pathophysiology:

  • CRISPR/Cas9 genome editing:

    • Generation of precise knock-in models carrying specific KCNJ10 mutations identified in patients

    • Cell-type specific or inducible knockout models to study tissue-specific functions

    • Base editing or prime editing for introducing subtle mutations without double-strand breaks

  • Cryo-electron microscopy:

    • Determination of high-resolution structures of KCNJ10 alone and in complex with KCNJ16

    • Visualization of conformational changes associated with channel gating and regulation

    • Structural insights into how disease-causing mutations affect channel architecture

  • Advanced electrophysiology platforms:

    • Automated patch clamp systems with increased throughput for mutation screening

    • Microelectrode array recordings to study network effects of KCNJ10 dysfunction in neural tissues

    • In vivo electrophysiology combined with optogenetics to study real-time potassium dynamics

  • Organ-on-chip technology:

    • Kidney-on-chip models incorporating KCNJ10-expressing cells to study tubular function

    • Brain-on-chip systems to investigate glial-neuronal interactions dependent on KCNJ10

    • Multi-organ systems to examine the interplay between different affected tissues in EAST syndrome

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize KCNJ10 localization and trafficking with nanometer precision

    • Potassium-sensitive fluorescent indicators to monitor real-time ion dynamics

    • Intravital microscopy to study KCNJ10 function in living animals

  • Computational approaches:

    • Molecular dynamics simulations to predict the effects of mutations on channel structure and function

    • Systems biology models integrating KCNJ10 function into cellular and tissue-level physiology

    • AI-assisted analysis of electrophysiological data to identify subtle functional defects

  • Single-cell technologies:

    • Single-cell transcriptomics to characterize the expression profile of cells expressing KCNJ10

    • Spatial transcriptomics to map KCNJ10 expression in complex tissues with spatial resolution

    • Multiomics approaches combining genomic, transcriptomic, and proteomic data

These emerging technologies offer unprecedented opportunities to deepen our understanding of KCNJ10 biology and accelerate the development of targeted therapies for KCNJ10-related disorders.

What are the most pressing unanswered questions in KCNJ10 research?

Despite significant advances in understanding KCNJ10 function and pathophysiology, several critical questions remain unanswered:

  • Regulatory mechanisms:

    • How is KCNJ10 expression and function regulated in different tissues under physiological and pathological conditions?

    • What posttranslational modifications affect KCNJ10 function, and how are these regulated?

    • How do cellular signaling pathways modulate KCNJ10 activity in an acute versus chronic manner?

  • Heteromer biology:

    • What determines the stoichiometry of KCNJ10/KCNJ16 heteromers in different tissues?

    • How does heteromerization affect channel pharmacology and potential therapeutic targeting?

    • Are there tissue-specific accessory proteins that modulate heteromer function?

  • Disease mechanisms:

    • Why do KCNJ10 mutations affect certain tissues more severely than others despite widespread expression?

    • What are the compensatory mechanisms that develop in response to chronic KCNJ10 dysfunction?

    • How do genetic modifiers influence the phenotypic expression of KCNJ10 mutations?

  • Therapeutic development:

    • Can channel activators or modulators be developed to enhance residual function of mutant KCNJ10?

    • Would tissue-specific approaches be necessary for effective therapy given the diverse roles of KCNJ10?

    • Could gene therapy approaches effectively restore KCNJ10 function in affected tissues?

  • Physiological roles:

    • What is the precise contribution of KCNJ10 to extracellular potassium homeostasis in different microenvironments?

    • How does KCNJ10 dysfunction in glia affect neuronal circuit function and contribute to epileptogenesis?

    • What is the role of KCNJ10 in less-studied tissues where it is expressed?

  • Clinical correlations:

    • What factors account for the variable severity of symptoms among patients with similar KCNJ10 mutations?

    • Are there biomarkers that could predict disease progression or treatment response?

    • Could KCNJ10 dysfunction contribute to more common disorders like idiopathic epilepsy or hearing loss?

  • Evolutionary considerations:

    • How has KCNJ10 function evolved across species and what can this tell us about its essential roles?

    • Are there species-specific differences in KCNJ10 regulation or heteromerization that affect translational research?

Addressing these questions will require interdisciplinary approaches combining molecular, cellular, physiological, and clinical research to advance our understanding of KCNJ10 biology and improve outcomes for patients with KCNJ10-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.