Recombinant Rat ATP-sensitive inward rectifier potassium channel 11 (Kcnj11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Kcnj11; ATP-sensitive inward rectifier potassium channel 11; BIR; Inward rectifier K(+ channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnj11
Target Protein Sequence
MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVF TTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALT LASSRGPLRKRSVAVAKAKPKFSISPDSLS
Uniprot No.

Target Background

Function
This G protein-coupled receptor belongs to the inward rectifier potassium channel family. These channels exhibit a preference for potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increasing extracellular potassium shifts the channel opening voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium block. Extracellular barium can block the channel. This protein can form cardiac and smooth muscle-type KATP channels with ABCC9, where KCNJ11 forms the channel pore, and ABCC9 is essential for activation and regulation.
Gene References Into Functions
  1. The E23K variant of the KATP channel increased susceptibility to ventricular arrhythmia under acute ischemic stress. PMID: 28082085
  2. Sarcolemmal ATP-sensitive K+ (sarcKATP) channel mutant subunit Kir6.2AAA transfection inhibited channel activity and significantly worsened myocyte apoptosis induced by lipopolysaccharides (LPS). PMID: 27430376
  3. Reduced Kir6.2 expression in the spinal cord is observed in bone cancer pain, and spinal Kir6.2 activation reduces bone cancer pain-associated hypersensitivity. PMID: 24480471
  4. Kir6.2 plays a crucial role in ischemic preconditioning and calcium and mitochondrial homeostasis during stress; decreased channel numbers negatively impact myocyte survival. PMID: 24014680
  5. The G156P mutation reduces PIP2's ability to stabilize the open state of Kir6.2 channels. PMID: 23700433
  6. Estradiol significantly upregulates the expression of KATP channel subunits and SUR1 activity in the brain cortices of ovariectomized rats. PMID: 23032400
  7. A Linear Interaction Energy method parameter set was defined to predict the effects of additional Kir6.2 mutations within the ATP binding site on ATP affinity. PMID: 23219002
  8. Channels with the Q52E mutation in Kir6.2 and E203C in SUR1 exhibit 100-fold higher ATP sensitivity than wild-type channels. PMID: 22802363
  9. HIF-2alpha binding to a putative hypoxia response element in the Kir6.2 gene promoter is validated in adrenal glands of pups born to nicotine-exposed dams. PMID: 22403787
  10. Activation of astrocytic mitochondrial K(ATP) channels improves gap junction function in astrocytes via regulation of gap junction-coupled spatial buffering in the hippocampus. PMID: 21474909
  11. ATP activates ATP-sensitive potassium channels composed of mutant sulfonylurea receptor 1 and Kir6.2 with reduced PIP2 sensitivity. PMID: 21654216
  12. A critical determinant in TMD0 controlling Kir6.2 gating by modulating channel sensitivity to PIP(2) was identified, revealing a novel K(ATP) channel inactivation mechanism involving aberrant SUR1-Kir6.2 coupling. PMID: 21321069
  13. K(ATP) channel activity was investigated in hippocampal H19-7 neurons treated with or without Kir6.2 mRNA-targeted siRNAs. PMID: 21145327
  14. Gastric responses to hyperglycemia and tolbutamide were absent in rats with Kir6.2 siRNA-treated nodose ganglia. PMID: 21193530
  15. Kir6.2 was found in most rat brain neuronal populations, as well as oligodendrocytes and astrocytes, located in the endoplasmic reticulum, Golgi apparatus, and cell membranes of glia and neurons. PMID: 12007828
  16. KATP channel activation in slow-twitch muscle is necessary for NKCC activation and cell volume restoration under hyperosmotic conditions. PMID: 14592811
  17. A direct interaction exists between Kir6.2 and a 65-amino-acid section of the cytoplasmic C-terminal region of rSUR2A (residues 1294-1358). PMID: 14672537
  18. KATP channels play a significant role in glucose sensing and insulin secretion, and ribozyme Kir6.2-gene targeting effectively inhibits KATP channel functional expression. PMID: 15166124
  19. Isl-1 moderates Kir6.2 expression in the rat intestine. PMID: 15528203
  20. Zinc activated KATP in cells co-expressing rat Kir6.2 and SUR1 subunits. PMID: 15613469
  21. Kir6.2 is widely expressed in all brain regions, suggesting it forms the pore of K-ATP channels in most neurons. PMID: 15739238
  22. Mutations in this gene should be considered not only for permanent neonatal diabetes but also for other milder, later-onset diabetes forms. PMID: 15784703
  23. 14,15-EET activates vascular K(ATP) channels through G(s)alpha ADP-ribosylation. PMID: 16537788
  24. PNDM mutations (Q52R, V59G, V59M, R201C, R201H, and I296L) reduce channel ATP sensitivity and impair cell surface expression. PMID: 16731837
  25. Sulfonylureas reverse trafficking defects caused by neonatal diabetes-associated Kir6.2 mutations, dependent on intact sulfonylurea binding sites in sulfonylurea receptor 1. PMID: 16956886
  26. Changes in hypothalamic Kir6.2 expression may be linked to hyperinsulinemia and hyperglycemia development. PMID: 18001323
  27. HSP90 is involved in K ATP-mediated cytoprotection, potentially by promoting Kir6.2 mitochondrial targeting. PMID: 18006464
  28. Kir6.2 subunit-subunit interactions are important for K(ATP) channel gating and function, revealing a novel gating defect underlying CHI. PMID: 18250167
  29. Testosterone may modulate male sexual behavior by regulating brain K(+)(ATP) channels. PMID: 18950632
  30. ARNT positively regulates Kir6.2 at the mRNA and protein levels. PMID: 19141293
Database Links

KEGG: rno:83535

STRING: 10116.ENSRNOP00000028685

UniGene: Rn.3985

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ11 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the KCNJ11 protein and what is its physiological role?

KCNJ11 (potassium inwardly rectifying channel, subfamily J, member 11) encodes the main subunit (Kir6.2) of the ATP-sensitive K+ (KATP) channel. The functional KATP channel consists of eight subunits: four Kir6.2 subunits produced from the KCNJ11 gene and four regulatory SUR1 subunits encoded by the ABCC8 gene, which together form a hetero-octameric complex .

In pancreatic β-cells, KATP channels play a critical role in glucose homeostasis by coupling cellular metabolism to insulin secretion. At low plasma glucose levels, KATP channel activity maintains membrane hyperpolarization, preventing electrical activity and insulin release. When blood glucose rises, enhanced β-cell glucose metabolism elevates cytosolic ATP, which binds to the KATP channel, causing it to close. This closure triggers membrane depolarization, electrical activity, and subsequently insulin secretion .

KCNJ11 is also expressed in various brain regions, with particularly high expression levels in the cerebellum, where it contributes to neurological functions beyond glucose homeostasis .

What are the standard specifications for recombinant rat KCNJ11 protein?

Standard recombinant rat KCNJ11 protein typically has the following specifications:

ParameterSpecification
SourceMammalian Cells
Common TagHis
FormLiquid or lyophilized powder
Endotoxin Level< 1.0 EU per μg of protein (LAL method)
Purity>80%
Storage BufferPBS buffer
Storage ConditionsShort-term: +4°C; Long-term: -20°C to -80°C

These specifications represent typical research-grade recombinant protein preparations suitable for in vitro studies, biochemical assays, and certain cell-based experiments .

How does rat KCNJ11 compare structurally and functionally to human KCNJ11?

Rat and human KCNJ11 share high sequence homology and conserved functional domains. Both encode the Kir6.2 subunit of KATP channels and maintain similar electrophysiological properties. The conservation of structure enables researchers to use rat KCNJ11 as a model for studying mechanisms potentially applicable to human physiology.

What methodologies are most effective for studying KCNJ11 channel function in vitro?

Multiple complementary approaches are recommended for comprehensive characterization of KCNJ11 channel function:

  • Patch-clamp electrophysiology: The gold standard for characterizing KATP channel activity, allowing direct measurement of channel opening, closing kinetics, and ATP sensitivity. Both whole-cell and single-channel recording configurations provide valuable and complementary information.

  • Fluorescence-based membrane potential assays: Useful for higher-throughput screening of channel modulators, though with less temporal resolution than electrophysiology.

  • Radioligand binding assays: Essential for quantifying interactions between KATP channels and pharmacological agents.

  • Co-immunoprecipitation studies: Valuable for investigating protein-protein interactions between Kir6.2 and regulatory subunits or other interacting partners.

  • FRET/BRET approaches: For real-time monitoring of conformational changes and protein interactions in living cells.

These methodologies can be employed with recombinant rat KCNJ11 protein in heterologous expression systems (e.g., HEK293 or CHO cells) or in primary β-cells from rat models to assess native channel properties .

How do specific mutations in KCNJ11 impact channel function and cellular physiology?

KCNJ11 mutations demonstrate diverse functional consequences depending on their location within the protein structure and the nature of the amino acid substitution. Two major categories of functional effects have been documented:

  • Loss-of-function mutations: These typically reduce or prevent KATP channel activity, leading to constant insulin release from β-cells. This mechanism underlies congenital hyperinsulinism, which presents clinically as hypoglycemia. More than 30 loss-of-function mutations have been identified, primarily affecting channel assembly, trafficking, or ATP sensitivity .

  • Gain-of-function mutations: These cause permanent neonatal diabetes mellitus (PNDM) by reducing the sensitivity of KATP channels to inhibition by ATP. This results in channel hyperactivity, preventing β-cell depolarization and insulin secretion even in the presence of elevated blood glucose. At least 30 such mutations have been documented .

The E23K polymorphism (rs5219) represents a particularly well-studied common variant associated with type 2 diabetes risk. Meta-analysis demonstrates an odds ratio of 1.15 for the risk allele T (encoding the K23 variant) . Functional studies in mouse models indicate that this variant accelerates diabetes progression, likely through altered channel sensitivity to metabolic regulators .

What are the challenges in developing specific antibodies against rat KCNJ11?

Developing specific antibodies against rat KCNJ11 presents several technical challenges:

  • High sequence conservation: The high degree of sequence homology between species can complicate the generation of rat-specific antibodies, as many epitopes are conserved across species.

  • Membrane protein complexity: As an integral membrane protein, KCNJ11 has limited exposed extracellular domains, restricting accessible epitopes for antibody generation.

  • Conformational sensitivity: The native conformation of channel subunits within the octameric complex may present epitopes that differ from the denatured protein used for immunization.

  • Cross-reactivity concerns: Antibodies may cross-react with other Kir family members due to conserved domains.

To address these challenges, researchers should consider:

  • Using recombinant protein fragments representing unique regions of rat KCNJ11

  • Rigorous validation through multiple techniques including Western blotting, immunoprecipitation, and immunocytochemistry

  • Comparing results in wildtype versus KCNJ11-knockout tissues as definitive controls

  • Using multiple antibodies targeting different epitopes to confirm findings

How do KCNJ11 mutations contribute to both neurological and metabolic phenotypes?

KCNJ11 mutations, particularly those causing permanent neonatal diabetes mellitus (PNDM), are associated with a distinct pattern of neurological impairments that persist into adulthood despite treatment of the diabetes with sulfonylureas. This dual phenotype reflects the expression of KCNJ11 in both pancreatic β-cells and numerous brain regions.

A comprehensive assessment of adults with KCNJ11 mutations revealed:

  • Neurological features: 7/8 individuals with KCNJ11 mutations demonstrated abnormal neurological examinations, with predominant features being subtle deficits in coordination and motor sequencing .

  • Developmental impacts: All studied individuals had delayed developmental milestones and/or required learning support or special schooling .

  • Neurobehavioral features: Approximately half of individuals exhibited features consistent with autism spectrum disorder .

  • Cognitive function: KCNJ11 mutations were associated with impaired attention, working memory, and perceptual reasoning, with reduced IQ (median IQ 76 for KCNJ11 mutations vs. 111 for INS mutations, p=0.02) .

  • Cerebellar involvement: The highest expression of KCNJ11 in the brain is in the cerebellum, which plays key roles in motor coordination, language, executive function, and mood regulation. Cerebellar abnormalities have been linked with autism, consistent with the observed phenotype .

Importantly, these features persist despite sulfonylurea therapy that effectively addresses the metabolic aspects of the disease, suggesting that the CNS features represent the major burden of KCNJ11 mutations in adult life .

What are the implications of common KCNJ11 variants for type 2 diabetes risk assessment?

Common variants in KCNJ11, particularly the E23K polymorphism (rs5219), have significant implications for type 2 diabetes (T2D) risk assessment:

  • Population prevalence: Approximately 58% of Caucasians carry at least one K risk allele (EK or KK genotype), with 13% having the KK genotype. Similar frequencies (~20% allelic frequency) are observed in Asian and Arabian populations .

  • Diabetes risk: Meta-analysis of 33 studies including 23,262 T2D patients and 27,042 controls demonstrated an odds ratio of 1.15 (95% CI) for the risk allele T (encoding K23) .

  • Functional mechanism: Mouse models with the K23 variant show accelerated diabetes progression, suggesting this polymorphism directly contributes to disease pathogenesis rather than being merely a marker .

  • Linkage disequilibrium: The E23K variant exists in strong linkage disequilibrium with the S1369A variant in the neighboring ABCC8 gene (r² = 0.56), complicating the isolation of independent effects .

What are best practices for expression and purification of functional recombinant rat KCNJ11?

Expression and purification of functional rat KCNJ11 requires careful consideration of multiple factors:

  • Expression system selection:

    • Mammalian cell systems (e.g., HEK293, CHO) are preferred for maintaining native post-translational modifications and proper folding .

    • Co-expression with SUR1 (ABCC8) is recommended for obtaining the complete functional octameric channel complex.

  • Construct design considerations:

    • Addition of affinity tags (commonly His-tag) facilitates purification without compromising function .

    • Signal peptides may enhance membrane targeting and subsequent protein yield.

    • Consider including TEV protease sites for tag removal if necessary for functional studies.

  • Solubilization and purification:

    • Gentle detergents (DDM, LMNG) are recommended for membrane protein extraction.

    • Two-step purification protocols (affinity chromatography followed by size exclusion) yield highest purity.

    • Maintain glycerol (10-15%) and reducing agents in all buffers to enhance stability.

  • Quality control measures:

    • Purity assessment: SDS-PAGE and western blotting (>80% purity standard) .

    • Endotoxin testing: LAL method with acceptance criteria <1.0 EU per μg .

    • Functional validation: Liposome reconstitution and electrophysiology to confirm channel activity.

  • Storage optimization:

    • For short-term storage: 4°C in PBS buffer with protease inhibitors .

    • For long-term storage: -20°C to -80°C with stabilizing excipients .

How can researchers effectively design CRISPR-based models to study KCNJ11 function?

CRISPR-Cas9 technology offers powerful approaches for investigating KCNJ11 function through various genetic modifications:

  • Knock-in of specific variants:

    • The E23K variant has been successfully introduced in mouse models using CRISPR-aided genome editing technology on a C57BL/6NTac genetic background .

    • Design considerations include PAM site proximity to the target mutation and minimizing off-target effects.

    • Homology-directed repair (HDR) templates should include the desired mutation plus silent mutations to prevent re-cutting.

  • Knockout models:

    • Complete KCNJ11 knockout models can reveal phenotypes related to channel absence.

    • Multiple guide RNAs targeting different exons can increase knockout efficiency.

    • Verification should include both genomic DNA sequencing and functional assays (e.g., patch clamp).

  • Conditional/inducible systems:

    • Tissue-specific promoters (e.g., RIP for β-cell specificity) coupled with Cre-loxP systems allow tissue-restricted gene modification.

    • Doxycycline-inducible systems permit temporal control of gene expression.

  • Validation approaches:

    • Thorough genotyping using sequencing and restriction fragment length polymorphism analysis.

    • Protein expression confirmation via western blotting.

    • Functional validation through glucose tolerance testing, insulin secretion assays, and electrophysiology.

  • Phenotyping considerations:

    • Standardize litter size and randomize experiments to reduce bias .

    • Conduct experiments in a blinded fashion regarding genotype .

    • Include comprehensive metabolic phenotyping (glucose tolerance, insulin sensitivity, in vivo and in vitro insulin secretion).

What controls and experimental designs are critical for studies examining KCNJ11 mutations?

Robust experimental design for KCNJ11 mutation studies requires careful consideration of controls and potential confounding factors:

  • Appropriate control groups:

    • Inclusion of wild-type controls on the same genetic background is essential.

    • For clinical studies, comparison with individuals with diabetes caused by mutations in other genes (e.g., INS mutations) helps control for diabetes-related cognitive features, as demonstrated in studies comparing KCNJ11 and INS mutation carriers .

  • Controlling for confounding variables:

    • In studies of neurological phenotypes, controlling for glycemic control is critical, as poor metabolic control can independently affect cognitive function .

    • Age-matching is important as brain development continues beyond childhood and adolescence .

    • Consider disease duration, especially for long-term complications.

  • Statistical considerations:

    • Power calculations should account for the typically small effect sizes of common variants (OR ~1.15 for E23K) .

    • Heterogeneity between studies is common (I² = 58.9% in meta-analyses) and should be addressed with random-effect models when appropriate .

    • Publication bias should be assessed using methods such as Begg's correlation analysis .

  • Mechanistic validation:

    • Combining clinical observations with functional studies in cell and animal models.

    • Using electrophysiology to directly measure channel function.

    • Employing imaging techniques to assess potential structural impacts (although MRI studies have not detected structural brain abnormalities in KCNJ11 mutation carriers) .

By implementing these controls and design considerations, researchers can generate more reliable and interpretable data on KCNJ11 function and the impact of its mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.