Recombinant Rat ATP-sensitive inward rectifier potassium channel 14 (Kcnj14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Kcnj14; Irk4; ATP-sensitive inward rectifier potassium channel 14; Inward rectifier K(+ channel Kir2.4; IRK-4; Potassium channel, inwardly rectifying subfamily J member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnj14
Target Protein Sequence
MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGNRRRGRFVKKDGHCNVR FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLTFWLIASLHGDLAAPP PPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG AVMAKMAKPKKRNETLVFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVI LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCS AKELDERAEQASHSPKSSFPGSLAAFCYENELALSCCQEEDEEEDTKEGTSAETPDRAAS PQALTPTLALTLPP
Uniprot No.

Target Background

Function

Inward rectifier potassium channels are characterized by a preferential influx of potassium ions into the cell. Their voltage dependence is modulated by extracellular potassium concentration; increasing external potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from intracellular magnesium blockade of outward current. KCNJ14 encodes low-conductance channels exhibiting low affinity for the channel blockers barium and cesium.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in motoneurons of cranial nerve motor nuclei within the general somatic and special visceral motor cell column.

Q&A

What is the molecular structure and function of KCNJ14?

KCNJ14 (Potassium Inwardly Rectifying Channel Subfamily J Member 14) is a protein-coding gene that produces an integral membrane protein functioning as an inward-rectifier type potassium channel. The protein belongs to the inward rectifier-type potassium channel family (TC 1.A.2.1), specifically the KCNJ14 subfamily . These channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it, a property known as inward rectification .

The voltage dependence of KCNJ14 channels is regulated by the concentration of extracellular potassium. As external potassium concentration increases, the voltage range of channel opening shifts toward more positive voltages. The inward rectification property is primarily due to blockage of outward current by internal magnesium .

KCNJ14 gives rise to low-conductance channels with a relatively low affinity for common potassium channel blockers such as Barium and Cesium, which distinguishes it from some other potassium channel subtypes .

How is KCNJ14 expression regulated in different tissues?

KCNJ14 expression patterns vary significantly across different tissues and can be altered in pathological conditions. In normal physiological states, KCNJ14 is expressed in multiple tissue types, with notable presence in neuronal tissues where it likely controls motor neuron excitability .

Research examining KCNJ14 expression across different cancer types has revealed significant variability. For example, when comparing expression between normal and tumor tissues, KCNJ14 is significantly upregulated in certain cancers such as colon adenocarcinoma (COAD) and liver hepatocellular carcinoma (LIHC), while being significantly downregulated in others including breast cancer (BRCA), lung adenocarcinoma (LUAD), and thyroid carcinoma (THCA) .

Interestingly, KCNJ14 expression may correlate with cancer progression in some tumors. Analysis of expression relative to pathological stages shows that KCNJ14 is downregulated with cancer progression in breast cancer, while showing higher expression in correlation with advancing pathological stages of colon adenocarcinoma, liver hepatocellular carcinoma, lung adenocarcinoma, esophageal adenocarcinoma, and stomach adenocarcinoma .

What are the common methodologies for studying KCNJ14 channel function?

Several methodological approaches can be employed to study KCNJ14 channel function:

  • Electrophysiological techniques: Patch-clamp recording remains the gold standard for characterizing ion channel function, allowing researchers to measure channel conductance, rectification properties, and response to changing ionic conditions. For KCNJ14, this would involve examining inward rectification properties and response to varying extracellular potassium concentrations.

  • Expression analysis: Quantitative PCR (qPCR), RNA sequencing, and protein detection methods such as Western blotting and immunohistochemistry can be used to measure KCNJ14 expression levels in different tissues or experimental conditions.

  • ELISA-based detection: Enzyme-linked immunosorbent assay techniques specifically designed for KCNJ14 detection can be valuable for quantifying protein levels in biological samples. These kits typically use KCNJ14 antibody-antigen interactions and HRP colorimetric detection systems .

  • Genetic manipulation approaches: Knockdown or knockout models, using techniques such as RNA interference or CRISPR-Cas9, allow for functional studies examining the physiological consequences of reduced or absent KCNJ14 expression.

  • Pharmacological manipulation: Using channel blockers like Barium and Cesium (noting that KCNJ14 has lower affinity for these blockers compared to other potassium channels) to modify channel function and observe resultant physiological effects.

How does KCNJ14 contribute to neuronal excitability and what are the implications for neurological disorders?

KCNJ14 plays a crucial role in neuronal physiology, particularly in regulating neuronal excitability. The channel is found in the cell soma, dendrites, and plasma membrane, where it contributes to maintaining resting membrane potential and modulating action potential thresholds .

Mechanistically, KCNJ14 functions through:

  • Potassium flux regulation: By mediating potassium ion import, KCNJ14 helps establish hyperpolarized resting potentials in neurons, which affects their excitability threshold.

  • Synaptic transmission modulation: KCNJ14 participates in synaptic transmission processes, potentially affecting neurotransmitter release and postsynaptic responses .

  • Dendritic integration: Its presence in dendrites suggests a role in processing and integrating synaptic inputs before they reach the cell body.

Research approaches to explore this connection might include:

  • Analyzing KCNJ14 sequence variants in patients with relevant neurological disorders

  • Developing animal models with altered KCNJ14 expression or function

  • Using electrophysiological techniques to characterize how disease-associated mutations affect channel properties

What is the relationship between KCNJ14 expression and cancer progression?

Recent comprehensive analyses have revealed significant associations between KCNJ14 expression and various aspects of cancer biology, suggesting its potential role as a biomarker or therapeutic target.

Furthermore, KCNJ14 expression correlates with several important cancer biomarkers:

  • Tumor Mutation Burden (TMB): Significant positive correlations with KCNJ14 expression were found in seven tumor types including LGG, LUAD, and KIRC, suggesting a potential connection to genomic instability .

  • Microsatellite Instability (MSI): KCNJ14 positively correlates with MSI in ten tumor types, including LUAD, breast cancer (BRCA), and liver hepatocellular carcinoma (LIHC) .

  • Genomic Instability Markers: Significant correlations were observed between KCNJ14 expression and markers of genomic instability such as loss of heterozygosity (LOH), homologous recombination deficiency (HRD), and mutant-allele tumor heterogeneity (MATH) .

  • Tumor Stemness: KCNJ14 expression correlates with DNA stemness index (DNAss) in multiple tumors, potentially connecting it to cancer stem cell properties .

  • Immune Infiltration: Significant correlations exist between KCNJ14 expression and immune cell infiltration in 28 out of 38 tumor types analyzed, suggesting potential implications for immunotherapy response .

These findings collectively suggest that KCNJ14 may function as a potential independent prognostic biomarker across various cancer types, with mechanisms that potentially involve modulation of cellular excitability, proliferation, or interaction with immune components.

How can contradictory data regarding KCNJ14 expression in different cancer types be reconciled?

Reconciling contradictory data regarding KCNJ14 expression in different cancer types requires careful consideration of several factors:

  • Tissue specificity: The baseline expression of KCNJ14 varies naturally between tissue types, which may explain why its dysregulation follows different patterns in different cancers. For example, KCNJ14 is downregulated in breast cancer (BRCA) but upregulated in colon adenocarcinoma (COAD) .

  • Methodological variations: Contradictions in reported expression levels, such as the discrepancy observed in lung adenocarcinoma (LUAD) between different databases (TIMER.2 vs. UALCAN), highlight the importance of methodological considerations . Different analytical platforms, normalization methods, and reference samples can all contribute to such inconsistencies.

  • Tumor heterogeneity: Cancer is highly heterogeneous, with molecular subtypes within the same anatomical classification often behaving as distinct diseases. KCNJ14 may have different roles in different molecular subtypes of the same cancer.

  • Context-dependent function: KCNJ14's role may vary depending on the tumor microenvironment, stage of disease, or co-occurring genetic alterations. Its expression may have different implications at different disease stages.

  • Functional redundancy: Other potassium channels might compensate for alterations in KCNJ14 expression in some tissues but not others, leading to tissue-specific consequences of altered expression.

Research strategies to address these contradictions include:

  • Performing integrative analyses that incorporate multiple data types

  • Stratifying analyses by molecular subtypes rather than anatomical classification alone

  • Validating findings across multiple independent cohorts

  • Using single-cell approaches to address intra-tumor heterogeneity

  • Conducting functional studies to determine the consequences of KCNJ14 modulation in different cellular contexts

What are the key considerations when designing experiments using recombinant rat KCNJ14?

When designing experiments using recombinant rat KCNJ14, researchers should consider several critical factors:

  • Expression system selection: The choice of expression system (bacterial, mammalian, insect cells) significantly impacts protein folding, post-translational modifications, and functional properties. Mammalian expression systems often provide more physiologically relevant conditions for proper folding and trafficking of membrane proteins like KCNJ14.

  • Vector design: Consider including appropriate tags (His, FLAG, etc.) for purification and detection without compromising protein function. For electrophysiological studies, fluorescent protein tags can help identify transfected cells.

  • Purification strategy: KCNJ14 is a multi-pass membrane protein, making purification challenging. Detergent selection is critical; too harsh detergents may denature the protein, while insufficient detergents may not extract it from membranes effectively.

  • Functional validation: After expression, validate that the recombinant protein retains expected functional properties:

    • Electrophysiological characteristics (inward rectification, conductance, etc.)

    • Response to varying extracellular potassium concentrations

    • Expected pharmacological responses (low affinity to Barium and Cesium blockers)

  • Storage conditions: Optimize buffer composition, temperature, and additives to maintain stability during storage. Membrane proteins often require specific conditions to prevent aggregation or denaturation.

  • Species differences: Consider that rat KCNJ14 may have subtle functional differences compared to human KCNJ14, which could impact translational relevance. Sequence alignment and functional comparison may be necessary when extrapolating findings.

  • Experimental controls: Include appropriate controls such as non-transfected cells, cells expressing known potassium channels with well-characterized properties, and pharmacological validation using channel blockers.

What are optimal detection methods for KCNJ14 in various experimental contexts?

Multiple detection methods can be employed for KCNJ14, each with specific advantages depending on the experimental context:

For protein detection:

  • Western blotting: Useful for semi-quantitative detection of KCNJ14 protein levels in tissue or cell lysates. Consider using specialized extraction protocols for membrane proteins to ensure efficient recovery. Validate antibody specificity using positive and negative controls.

  • Immunohistochemistry/Immunofluorescence: Valuable for examining KCNJ14 localization within tissues or cells. Double-labeling with markers for cellular compartments (plasma membrane, endoplasmic reticulum) can provide insights into trafficking and localization.

  • ELISA: Microwell, strip plate ELISA kits designed for KCNJ14 detection provide quantitative measurements in biological samples. These typically employ KCNJ14 antibody-antigen interactions and HRP colorimetric detection systems .

  • Flow cytometry: For cell surface expression analysis in intact cells, particularly useful when examining heterogeneous cell populations.

For RNA detection:

  • RT-qPCR: Provides sensitive quantification of KCNJ14 mRNA levels. Design primers spanning exon-exon junctions to avoid genomic DNA amplification.

  • RNA-seq: Offers comprehensive analysis of expression in the context of the whole transcriptome, allowing for identification of co-regulated genes.

  • In situ hybridization: Allows visualization of KCNJ14 mRNA in tissue sections, providing spatial information about expression patterns.

For functional assessment:

  • Patch-clamp electrophysiology: Gold standard for functional characterization, allowing direct measurement of channel activity under various conditions.

  • Fluorescent potassium indicators: Can provide indirect measurement of potassium flux in cell populations.

  • Membrane potential dyes: Allow assessment of cellular responses that may involve KCNJ14 activity.

Table 1: Comparison of KCNJ14 Detection Methods

MethodSample TypeAdvantagesLimitationsBest For
Western BlotProtein lysatesSemi-quantitative, detects specific protein sizePoor spatial information, membrane protein extraction challengesRelative protein level comparison
ImmunohistochemistryTissue sectionsProvides spatial information, preserves tissue contextSemi-quantitative, antibody specificity concernsLocalization studies
ELISABody fluids, tissue homogenatesQuantitative, high throughputRequires validated antibodies, limited spatial informationQuantitative protein measurements
RT-qPCRRNA extractsHighly sensitive, quantitativeMeasures mRNA not protein, doesn't show localizationGene expression quantification
Patch-clampLiving cellsDirect functional measurementLow throughput, technically demandingChannel functional characterization

How can researchers effectively optimize transfection and expression of recombinant KCNJ14?

Optimizing transfection and expression of recombinant KCNJ14 requires systematic approach to multiple variables:

  • Cell line selection:

    • HEK293 cells are often preferred for ion channel expression due to low endogenous channel expression

    • CHO cells provide stable expression for long-term studies

    • Consider using neuronal cell lines for more physiologically relevant contexts

  • Vector optimization:

    • Use strong promoters appropriate for your cell type (CMV for most mammalian cells)

    • Include Kozak sequence for optimal translation initiation

    • Consider codon optimization for the expression system

    • For membrane proteins like KCNJ14, include sequences that enhance membrane trafficking

  • Transfection method optimization:

    • Lipid-based transfection: Optimal lipid:DNA ratio needs empirical determination

    • Electroporation: Cell-specific voltage and capacitance parameters require optimization

    • Viral transduction: Provides high efficiency in difficult-to-transfect cells

    • Nucleofection: Effective for primary cells

  • Expression conditions:

    • Temperature: Lower temperatures (30-32°C) sometimes improve folding of membrane proteins

    • Incubation time: Determine optimal expression window (typically 24-72 hours post-transfection)

    • Media supplements: Channel modulators or chemical chaperones may enhance functional expression

  • Verification strategies:

    • Co-express with fluorescent reporters to identify transfected cells

    • Use epitope tags that don't interfere with channel function

    • Perform functional assays at different time points to determine optimal expression window

  • Troubleshooting low expression:

    • Test multiple cell lines if expression is consistently low

    • Verify DNA quality and sequence integrity

    • Consider stable cell line generation for consistent expression

    • Evaluate protein degradation pathways that might affect KCNJ14 stability

  • Expression validation:

    • Western blotting to confirm protein expression at expected molecular weight

    • Surface biotinylation to assess membrane trafficking

    • Immunofluorescence to evaluate subcellular localization

    • Functional assays to confirm channel activity

How can KCNJ14 research contribute to understanding potassium channel-related diseases?

Research on KCNJ14 can significantly advance our understanding of potassium channel-related diseases through several pathways:

  • Channelopathies: KCNJ14 has been associated with Andersen Cardiodysrhythmic Periodic Paralysis, a rare genetic disorder characterized by episodes of muscle weakness, cardiac arrhythmias, and developmental abnormalities . Studying KCNJ14 dysfunction can provide insights into the pathophysiology of this and potentially other channelopathies.

  • Neurological disorders: Given KCNJ14's role in controlling motor neuron excitability , research may illuminate mechanisms underlying neurological conditions characterized by altered neuronal excitability, such as epilepsy, motor neuron diseases, or certain movement disorders.

  • Cardiovascular diseases: Inward rectifier potassium channels play critical roles in cardiac electrophysiology. Research on related potassium channels has shown their importance in blood pressure regulation. For example, studies with ROMK (another potassium channel) knockout rats demonstrated protection from salt-induced blood pressure elevation , suggesting potassium channels like KCNJ14 might have similar roles in cardiovascular pathophysiology.

  • Cancer biology: Comprehensive analysis has revealed connections between KCNJ14 expression and cancer progression across multiple tumor types . This suggests KCNJ14 could serve as a biomarker or potential therapeutic target, particularly given its correlations with immune infiltration and genomic instability markers.

Methodological approaches for exploring these connections include:

  • Genetic association studies in patient populations

  • Development of animal models with altered KCNJ14 function

  • Cell-based models exploring the consequences of KCNJ14 mutations

  • High-throughput screening for compounds that modulate KCNJ14 activity

  • Translational studies connecting basic mechanistic findings to clinical observations

What are the implications of KCNJ14's association with immune infiltration in cancer research?

The correlation between KCNJ14 expression and immune cell infiltration in tumors presents several significant implications for cancer research:

  • Biomarker potential: KCNJ14 expression levels could potentially serve as a biomarker to predict immunotherapy response. Research has shown significant correlations between KCNJ14 expression and immune cell infiltration in 28 out of 38 tumor types analyzed .

  • Immunotherapy targeting: The association with immune infiltration suggests KCNJ14 might play a role in shaping the tumor immune microenvironment. This connection could be leveraged to develop novel immunotherapeutic approaches or improve existing ones.

  • Mechanistic insights: The correlation raises questions about the mechanistic link between potassium channel function and immune response. Potential mechanisms include:

    • Modulation of membrane potential affecting immune cell activation

    • Regulation of cytokine secretion and inflammatory signaling

    • Influence on immune cell migration or retention within the tumor microenvironment

  • Combination therapy strategies: Understanding KCNJ14's role in immune infiltration could inform rational combination therapies that target both the channel (or its downstream effects) and immune checkpoints.

  • Patient stratification: KCNJ14 expression patterns could potentially help stratify patients for clinical trials or treatment selection, particularly for immunotherapies where predictive biomarkers are still needed.

Research approaches to explore these implications include:

  • Correlative studies examining KCNJ14 expression and response to immunotherapy in patient cohorts

  • Mechanistic studies using genetic manipulation of KCNJ14 in immune and cancer cells

  • Single-cell analyses to understand cell-specific expression and effects

  • Development of small molecule modulators of KCNJ14 as potential therapeutic agents

  • Animal models to test the impact of KCNJ14 modulation on immune response to tumors

How can researchers apply knowledge of KCNJ14 to develop novel therapeutic approaches?

Knowledge of KCNJ14 structure, function, and pathophysiological roles can be leveraged to develop several therapeutic approaches:

  • Small molecule modulators:

    • Channel activators or inhibitors could be developed through rational drug design or high-throughput screening

    • The low affinity of KCNJ14 to common potassium channel blockers like Barium and Cesium suggests the possibility of developing highly selective modulators

    • Structure-activity relationship studies could optimize compounds for specificity, efficacy, and pharmacokinetic properties

  • Gene therapy approaches:

    • For conditions associated with KCNJ14 deficiency, viral vector-mediated gene delivery could restore expression

    • For conditions with pathological overexpression, RNA interference or CRISPR-based approaches could reduce expression

    • Precise gene editing could correct specific mutations in hereditary channelopathies

  • Biologics development:

    • Antibodies targeting extracellular domains of KCNJ14 could modulate channel function

    • Peptide mimetics designed to interact with channel pores or regulatory domains

    • Exosome-based delivery of regulatory microRNAs that modulate KCNJ14 expression

  • Cancer therapeutics:

    • Given KCNJ14's association with cancer biomarkers and immune infiltration , it could serve as a target in oncology

    • Potential applications include combination with immunotherapies or targeting cancer types where KCNJ14 overexpression correlates with poor prognosis

    • KCNJ14 expression could serve as a biomarker for patient stratification in clinical trials

  • Drug delivery systems:

    • Nanoparticle-based delivery of KCNJ14 modulators to specific tissues

    • Cell-specific targeting strategies to minimize off-target effects

    • Controlled release formulations for sustained therapeutic effect

Development pathway considerations include:

  • Target validation through multiple orthogonal approaches

  • Assay development for high-throughput screening

  • Medicinal chemistry optimization of lead compounds

  • In vitro and in vivo efficacy and safety testing

  • Translational studies connecting preclinical findings to clinical applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.