Recombinant Rat ATP-sensitive inward rectifier potassium channel 1 (Kcnj1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Kcnj1; Romk1; ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K; Inward rectifier K(+ channel Kir1.1; KAB-1; Potassium channel, inwardly rectifying subfamily J member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Kcnj1
Target Protein Sequence
MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY NEKDARARMKRGYDNPNFVLSEVDETDDTQM
Uniprot No.

Target Background

Function

In the kidney, Kcnj1 (ATP-sensitive inward rectifier potassium channel 1) likely plays a crucial role in potassium homeostasis. Inward rectifier potassium channels exhibit a greater influx of potassium ions into cells compared to efflux. Their voltage dependence is modulated by extracellular potassium concentration: increased extracellular potassium shifts the channel opening to more positive voltages. Inward rectification primarily results from internal magnesium ion blockage of outward current. This channel is activated by intracellular ATP and can be inhibited by extracellular barium.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly in kidney (renal cortex, medulla and papilla). In the brain, found in the cortex and the hippocampus.

Q&A

What are the electrophysiological properties of rat KCNJ1 channels?

Rat KCNJ1 channels display several distinctive electrophysiological properties:

  • Single-channel conductance: In symmetrical high K+ conditions (~140 mM), KCNJ1 exhibits an ohmic conductance of 70-80 pS .

  • Ion selectivity: The channel is highly selective for potassium, with a PNa/PK ratio of approximately 0.01 .

  • ATP sensitivity: Channel activity is inhibited by ATP with a Ki of 10-500 μM .

  • Rectification characteristics: KCNJ1 functions as a weak inward rectifier .

  • Pharmacological properties: The channel is blocked by Ba2+ ions and can be activated by diazoxide, a KATP channel opener .

When expressed in heterologous systems such as Xenopus laevis oocytes, recombinant rat KCNJ1 (uKATP-1) manifests as a weak rectifier that is blocked by Ba2+ ions. In HEK293 cells transfected with KCNJ1 cDNA, patch-clamp studies reveal ATP sensitivity (1 mM ATP causes channel closure) and a single-channel conductance of approximately 70 ± 2 picosiemens .

How does rat KCNJ1 compare structurally to other inward rectifier K+ channels?

Rat KCNJ1 (originally termed uKATP-1) represents a distinct subfamily within the inward rectifier K+ channel family. Sequence analysis shows that KCNJ1 shares only 43-46% amino acid identity with other inward rectifier K+ channel subfamilies, including ROMK1, IRK1, GIRK1, and cKATP-1 . This relatively low sequence homology indicates that KCNJ1 is not an isoform of these other subfamilies but rather represents a separate subfamily of inward rectifier K+ channels.

Like other members of the inward rectifier family, KCNJ1 has a structural architecture featuring two transmembrane segments . This distinguishes it from voltage-gated potassium channels, which typically contain six transmembrane domains. The rat KCNJ1 protein consists of 424 amino acid residues with a molecular weight (Mr) of 47,960 .

What expression systems are most effective for recombinant rat KCNJ1?

Several expression systems have been successfully employed for recombinant rat KCNJ1, each with distinct advantages:

  • Xenopus laevis oocytes: This system has been effectively used for electrophysiological studies of rat KCNJ1 (uKATP-1). Oocytes provide a robust platform for functional characterization using two-electrode voltage clamp and patch-clamp techniques .

  • Mammalian cell lines: HEK293 cells (human embryonic kidney cells) have been successfully transfected with rat KCNJ1 cDNA, enabling single-channel patch-clamp studies that revealed the ATP sensitivity and conductance properties of the channel .

  • Saccharomyces cerevisiae: The eukaryotic budding yeast has emerged as an excellent system for expression of human KCNJ channels, with 10 out of 11 tested KCNJ channels successfully expressed. This system is particularly valuable for protein purification purposes and structural studies .

For research focusing on protein structure or requiring purified protein, the yeast system offers advantages including proper trafficking to the plasma membrane (suggesting proper folding), the ability to scale up production, and established purification protocols. For electrophysiological characterization, both oocytes and mammalian cell lines provide appropriate cellular environments for functional studies .

What are the recommended methods for expressing and purifying recombinant KCNJ1 in yeast?

For successful expression and purification of recombinant KCNJ1 in yeast, the following methodology is recommended:

Vector Construction:

  • Utilize a vector containing a strong inducible promoter such as GAL1

  • Include C-terminal tags (FLAG and octa-histidine) for purification

  • Design forward primers with appropriate overhang sequences for homologous recombination

Transformation and Expression:

  • Transform the prepared vector containing KCNJ1 into the FGY217 strain of S. cerevisiae using a Li-acetate/SS carrier DNA protocol

  • Plate transformants on SC-Ura plates and grow for 3 days

  • Verify successful transformation using colony PCR

  • Culture colonies in SC-Ura media with 2% glucose, then induce expression by transferring to media with 2% galactose

Purification Process:

  • Isolate crude membranes through centrifugation

  • Implement a 2-step purification procedure, utilizing the C-terminal tags

  • Verify trafficking to the plasma membrane using confocal microscopy of GFP-fusion in whole cells, which indicates proper folding through the yeast's extensive quality control systems for ER exit (ERAD)

This protocol has been validated for multiple KCNJ channels, with expression levels ranging from 40 to 400 μg/L, making it suitable for structural and functional studies requiring purified protein .

How can I verify the functional integrity of recombinant KCNJ1?

Verifying the functional integrity of recombinant KCNJ1 requires a multi-faceted approach:

  • Electrophysiological Characterization:

    • Perform patch-clamp recordings in either whole-cell or single-channel configurations

    • Verify characteristic conductance (70-80 pS in symmetrical K+ conditions)

    • Confirm ATP sensitivity (inhibition with Ki of 10-500 μM)

    • Demonstrate block by Ba2+ ions

    • Test activation by known KATP channel openers like diazoxide

  • Ion Selectivity Assessment:

    • Measure K+ selectivity (PNa/PK ratio of approximately 0.01)

    • Verify weak inward rectification properties

  • Subcellular Localization:

    • When expressed in yeast, proper trafficking to the plasma membrane (visualized by confocal microscopy of GFP-fusion proteins) indicates correct folding

    • In mammalian cells, immunohistochemistry with antibodies against KCNJ1 can verify localization patterns

  • Pharmacological Validation:

    • Response to known modulators provides functional verification

    • ATP inhibition and diazoxide activation serve as key pharmacological signatures

For recombinant rat KCNJ1 expressed in heterologous systems, functional integrity is primarily confirmed when the channel displays ATP sensitivity, appropriate single-channel conductance, and expected pharmacological responses, closely matching the properties observed in native tissues.

What patch-clamp protocols are recommended for studying rat KCNJ1 channels?

The following patch-clamp protocols are recommended for comprehensive characterization of rat KCNJ1 channels:

Single-Channel Recordings:

  • Use symmetrical high K+ solution (approximately 140 mM) to maximize current amplitude

  • Record in inside-out patch configuration to access the cytoplasmic face for ATP application

  • Apply voltage steps from -100 mV to +100 mV to characterize rectification properties

  • Add ATP (10 μM to 1 mM) to the bath solution to assess ATP sensitivity

  • Apply Ba2+ ions to confirm channel identity through characteristic block

Whole-Cell Recordings:

  • Use physiological K+ concentrations to mimic in vivo conditions

  • Apply voltage ramps from -120 mV to +40 mV to assess rectification

  • Measure current-voltage relationships before and after application of channel modulators

  • For stretch sensitivity studies, mechanically stretch cardiomyocytes using a glass stylus while recording to observe activation of outwardly rectifying K+ currents

Additional Considerations:

  • For ATP sensitivity, the inside-out configuration is optimal as it allows direct access to the cytoplasmic domain

  • To study TREK-like properties in cardiac tissue, both positive and negative pressure can be applied to patches to evaluate mechanosensitivity

  • Record at room temperature (20-25°C) for stable recordings, though physiological temperature (37°C) more closely mimics in vivo conditions

These protocols have been successfully applied to characterize KCNJ1 and related channels in various expression systems, including Xenopus oocytes, HEK293 cells, and native cardiomyocytes .

How does ATP regulate KCNJ1 channel activity?

ATP regulates KCNJ1 channel activity through direct interaction with the channel's cytoplasmic domains, serving as a crucial link between cellular metabolism and membrane excitability:

Mechanism of ATP Inhibition:

  • ATP binds to cytoplasmic domains of KCNJ1, causing conformational changes that lead to channel closure

  • The inhibition occurs with a Ki ranging from 10-500 μM, depending on experimental conditions and the specific KCNJ1 variant

  • Single-channel patch clamp studies reveal that application of 1 mM ATP to the cytoplasmic face causes KCNJ1 (uKATP-1) closure

Physiological Significance:

  • This ATP sensitivity allows KCNJ1 to function as a metabolic sensor, adjusting membrane excitability based on cellular energy status

  • During metabolic stress when ATP levels fall, KCNJ1 channels open, hyperpolarizing the membrane and reducing cellular activity

  • In tissues like pancreatic β-cells, this mechanism links glucose metabolism to insulin secretion, while in cardiac tissue it may provide protective hyperpolarization during ischemia

Modulation of ATP Sensitivity:

  • The ATP sensitivity of KCNJ1 can be modulated by pharmaceutical agents such as diazoxide, which activates the channel even in the presence of ATP

  • Intracellular factors including pH and certain lipids may also influence the channel's ATP sensitivity

  • Specific mutations in KCNJ1 can alter ATP sensitivity, potentially contributing to pathological conditions

This ATP-dependent regulation represents a fundamental mechanism by which KCNJ1 couples cellular metabolism to membrane excitability across multiple tissues where the channel is expressed.

What methodological approaches are used to study KCNJ1 mutations?

Research on KCNJ1 mutations employs several complementary methodological approaches to understand their functional consequences:

Computational Prediction and Screening:

  • Genomic database mining to identify potential disease-associated variants

  • Computational platforms like Rhapsody that utilize evolutionary conservation along with structural and dynamic features to predict the impact of variants

  • Prediction validation through comparison with known disease-associated mutations

Yeast-Based Functional Screening:

  • Expression of KCNJ1 variants in yeast to assess their functional impact

  • Growth assays in yeast expressing select KCNJ1 mutants, sometimes in the context of a hyperactive channel mutation (K80M) to improve the dynamic range of the assay

  • Comparative analysis of growth defects to classify mutations as deleterious, moderate, or benign

Mammalian Cell Electrophysiology:

  • Heterologous expression of mutant channels in mammalian cell lines

  • Patch-clamp recording to assess changes in:

    • Channel conductance

    • ATP sensitivity

    • Gating kinetics

    • Ion selectivity

    • Pharmacological responses

Protein Trafficking and Processing Studies:

  • Assessment of mutant protein folding in the endoplasmic reticulum

  • Determination of protein degradation via the ER-associated degradation (ERAD) pathway

  • Evaluation of surface expression through immunohistochemistry or surface biotinylation

For Bartter syndrome-associated mutations in KCNJ1, research has revealed that some mutations compromise ROMK folding in the endoplasmic reticulum, resulting in premature degradation via the ERAD pathway . This systematic approach combining computational prediction, functional screening, and detailed electrophysiological characterization provides comprehensive insights into how mutations affect channel function and contribute to disease states.

How are KCNJ1 variants linked to blood pressure regulation?

KCNJ1 variants have been implicated in blood pressure regulation through several lines of evidence:

Genetic Association Studies:
Research examining common variants in genes underlying monogenic hypertension and hypotension has identified significant associations between KCNJ1 polymorphisms and blood pressure in the general population. In a study of 2037 adults from 520 nuclear families characterized for 24-hour ambulatory blood pressure:

  • Five polymorphisms in the KCNJ1 gene showed associations with mean 24-hour systolic or diastolic blood pressure

  • The strongest association was with an intronic polymorphism, rs2846679, where the minor allele (frequency 16%) was associated with a −1.58 (95% CI −2.47 to −0.69) mm Hg change in mean 24-hour systolic blood pressure

  • Multiple SNPs in KCNJ1 showed associations with blood pressure reduction, with variants located in both intronic regions and the 3' untranslated region

Detailed Blood Pressure Effects:
The specific effects observed include:

SNP IDLocationMinor Allele FrequencyEffect on SBP (mm Hg)Effect on DBP (mm Hg)FPRP
rs2846679Intronic16%-1.58 (95% CI -2.47 to -0.69)Not specified0.05
Other associated SNPsIntronic/3'UTRVariedReductionReduction≤0.2

Pathophysiological Mechanism:
The link between KCNJ1 variants and blood pressure likely stems from the channel's critical role in renal potassium handling and salt reabsorption. In the kidney, KCNJ1 (ROMK) contributes to potassium secretion and sodium reabsorption in the thick ascending limb and collecting duct. Alterations in channel function can affect:

  • Sodium and water reabsorption, influencing blood volume

  • Potassium secretion, affecting vascular tone

  • Renin-angiotensin-aldosterone system activation

This research highlights the importance of KCNJ1 in blood pressure homeostasis and suggests that common genetic variation in this gene contributes to blood pressure variation in the general population, beyond its established role in monogenic disorders like Bartter syndrome.

What techniques are used to study KCNJ1 structure-function relationships?

Investigation of KCNJ1 structure-function relationships employs multiple complementary approaches:

Recombinant Protein Expression and Purification:

  • Expression in eukaryotic systems like Saccharomyces cerevisiae, which provides proper protein folding and trafficking

  • Implementation of two-step purification processes using affinity tags (FLAG, His-tag)

  • Verification of protein integrity through size-exclusion chromatography and functional assays

Site-Directed Mutagenesis:

  • Systematic mutation of specific amino acids to investigate their role in:

    • Channel gating

    • ATP binding and sensitivity

    • Ion selectivity

    • Rectification properties

  • Creation of chimeric channels combining segments from different potassium channel subfamilies to identify functional domains

Electrophysiological Characterization:

  • Patch-clamp recording of wild-type and mutant channels to assess functional properties

  • Single-channel analysis to determine conductance, open probability, and kinetics

  • Whole-cell recording to evaluate macroscopic current characteristics and pharmacological responses

  • Application of specific stimuli (ATP, pH changes, mechanical stretch) to probe regulatory mechanisms

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation to identify binding partners

  • FRET/BRET techniques to assess dynamic interactions in living cells

  • Pull-down assays to confirm direct biochemical interactions

Structural Analysis:

  • X-ray crystallography of purified recombinant protein (based on successful approaches with related channels like mouse Kir6.2 and chicken Kir2.2)

  • Cryo-electron microscopy for high-resolution structural determination

  • Molecular dynamics simulations to predict conformational changes during gating and ATP binding

These integrated approaches have yielded insights into how KCNJ1's structure relates to its function as an ATP-sensitive inward rectifier potassium channel, and continue to be refined to address remaining questions about channel regulation and disease-causing mutations.

How does KCNJ1 function in cardiac tissue?

KCNJ1 function in cardiac tissue reveals specialized roles related to mechanoelectrical coupling and cardiac protection:

Localization and Expression Pattern:
Immunohistochemistry with antibodies against TREK-1 (a mechanosensitive potassium channel with properties similar to some KCNJ1 modes) has shown localization in longitudinal stripes at the external surface membrane of cardiomyocytes . This patterned distribution suggests specialized roles in responding to mechanical forces during the cardiac cycle.

Stretch-Activated Properties:
When cardiomyocytes are mechanically stretched, an outwardly rectifying K+ current component can be detected in whole-cell recordings . This mechanosensitivity may serve as a protective mechanism during the filling phase of the cardiac cycle.

Conductance Modes in Cardiac Tissue:
Single-channel recordings with symmetrical high K+ solution have identified two TREK-like channels with 'flickery-burst' kinetics in cardiac tissue:

  • A 'large conductance' K+ channel (132 ± 5 pS at positive potentials)

  • A 'low-conductance' channel (41 ± 5 pS at positive potentials)

The low-conductance channel can be activated by:

  • Negative pressure in inside-out patches

  • Positive pressure in outside-out patches

  • Intracellular acidification

  • Application of arachidonic acid

Physiological Significance:
The current flowing through mechanogated KCNJ1-related channels may serve to counterbalance the inward current flowing through stretch-activated non-selective cation channels during the filling phase of the cardiac cycle. This counterbalancing effect could prevent the occurrence of ventricular extrasystoles .

Dual Mode Operation:
Research suggests that the two TREK-like channels found in rat cardiomyocytes may reflect two different operating modes of a single channel type, with the low-conductance channels representing the major operating mode in cardiac tissue . This functional versatility allows the channel to adapt to different physiological demands within the heart.

How do mutations in KCNJ1 contribute to Bartter's Syndrome?

Mutations in KCNJ1 are causatively linked to Type II Bartter's Syndrome, a rare genetic disorder characterized by salt wasting, hypokalemic metabolic alkalosis, and normal to low blood pressure:

Molecular Basis:

  • Over 40 Bartter syndrome-associated mutations in KCNJ1 have been identified

  • Mutations can affect the channel in various ways, including:

    • Compromised protein folding in the endoplasmic reticulum

    • Premature degradation via the ER-associated degradation (ERAD) pathway

    • Altered channel conductance or gating

    • Disrupted ATP sensitivity or regulation

Specific Examples:

  • E151K mutation and deletion of amino acids 116–119 have been identified in infants with Bartter syndrome

  • F93V and V122E mutations predicted to be deleterious by computational analysis (Rhapsody) showed measurable growth defects in yeast expression systems

  • L320P and R311Q mutations were classified as having "moderate" effects on channel function

Pathophysiological Mechanism:
KCNJ1 encodes the renal outer medullary potassium channel (ROMK), which plays a crucial role in potassium recycling in the thick ascending limb of Henle's loop and potassium secretion in the cortical collecting duct. Loss-of-function mutations lead to:

  • Impaired potassium recycling across the apical membrane of the thick ascending limb

  • Reduced function of the Na-K-2Cl cotransporter (NKCC2)

  • Decreased sodium chloride reabsorption

  • Increased distal tubular flow and sodium delivery

  • Subsequent salt wasting, hypokalemia, and metabolic alkalosis

Genotype-Phenotype Correlations:
The severity and specific presentation of Bartter syndrome can vary based on the nature of the KCNJ1 mutation. Some mutations completely abolish channel function, while others result in partial loss of function, leading to variable clinical phenotypes. The correlation between specific mutations and clinical presentations remains an active area of research .

What methodological approaches are used to identify novel therapeutic targets for KCNJ1-related disorders?

Research into novel therapeutic targets for KCNJ1-related disorders employs several sophisticated methodological approaches:

Genomic and Computational Screening:

  • Mining of genomic databases (UK Biobank, gnomAD, ClinVar) to identify disease-associated variants

  • Application of computational platforms like Rhapsody that integrate evolutionary conservation with structural and dynamic features to predict variant impacts

  • Prioritization of variants for functional validation based on computational predictions

Functional Screening Systems:

  • Yeast-based expression systems for high-throughput screening of channel function

  • Implementation of growth assays in yeast expressing KCNJ1 variants

  • Development of improved signal-to-noise assays through co-expression with hyperactive channel mutations (e.g., K80M)

Structure-Guided Drug Design:

  • Utilization of structural information from related inward rectifier channels (including bacterial homologues KirBac1.1, KirBac3.1, and KirBac1.3, as well as mouse Kir6.2 and chicken Kir2.2)

  • Identification of druggable binding pockets on the channel structure

  • Virtual screening of compound libraries to identify potential modulators

  • Rational design of channel activators or inhibitors based on structural insights

High-Throughput Pharmacological Screening:

  • Development of cell-based fluorescent or luminescent assays for channel activity

  • Screening of chemical libraries to identify compounds that modulate channel function

  • Secondary validation of hits using electrophysiological approaches

  • Structure-activity relationship studies to optimize lead compounds

Animal Models:

  • Generation of transgenic rodent models expressing human KCNJ1 mutations

  • Characterization of renal phenotypes and electrolyte abnormalities

  • Testing of candidate therapeutic compounds in disease models

  • Assessment of efficacy and safety profiles

The integration of these approaches facilitates the identification of novel therapeutic targets and compounds that may restore channel function in loss-of-function mutations or modulate activity in gain-of-function scenarios. The KCNJ channel family presents an attractive target for the development of novel therapeutic agents for numerous diseases, including Bartter's Syndrome, certain cardiac disorders, and potentially hypertension .

What are the current limitations in KCNJ1 research and how might they be addressed?

Current research on KCNJ1 faces several significant limitations that require innovative approaches to overcome:

Expression and Purification Challenges:

  • Limitation: Obtaining sufficient quantities of purified, functional human KCNJ1 for structural studies has been difficult, with no published examples of human inward rectifiers recombinantly expressed and purified in a functional form to sufficient levels .

  • Solution: Development of optimized expression systems in eukaryotic hosts like Saccharomyces cerevisiae has shown promise, with successful expression of 10 out of 11 tested KCNJ channels. Further refinement of purification protocols and stability conditions could enhance protein yield and quality .

Structural Determination Barriers:

  • Limitation: Unlike some bacterial homologues (KirBac1.1, KirBac3.1) and animal channels (mouse Kir6.2, chicken Kir2.2), high-resolution structures of human or rat KCNJ1 remain elusive .

  • Solution: Application of advanced cryo-electron microscopy techniques, which require less protein than crystallography and can capture multiple conformational states, may accelerate structural determination of KCNJ1 channels.

Heterogeneity in Channel Properties:

  • Limitation: KCNJ1 channels can exhibit variable conductance states and operating modes, complicating functional characterization and pharmacological targeting .

  • Solution: Single-molecule approaches and improved electrophysiological techniques that can distinguish between channel subpopulations could help clarify the molecular basis for these different operating modes.

Genotype-Phenotype Correlation Challenges:

  • Limitation: The relationship between specific KCNJ1 mutations and clinical phenotypes in Bartter syndrome and other disorders remains incompletely understood .

  • Solution: Systematic functional characterization of disease-associated variants using standardized protocols, combined with comprehensive clinical phenotyping and registry development, could strengthen genotype-phenotype correlations.

Tissue-Specific Function Understanding:

  • Limitation: While KCNJ1 is expressed ubiquitously, its tissue-specific functions outside the kidney are poorly characterized .

  • Solution: Development of tissue-specific conditional knockout models and single-cell transcriptomic approaches could elucidate KCNJ1's diverse roles across tissues.

Addressing these limitations through technological innovation and interdisciplinary approaches will advance our understanding of KCNJ1 biology and potentially open new therapeutic avenues for KCNJ1-related disorders.

What emerging technologies are transforming KCNJ1 research?

Several cutting-edge technologies are revolutionizing our approach to KCNJ1 research:

Cryo-Electron Microscopy (Cryo-EM):

  • Enables visualization of membrane proteins like KCNJ1 without crystallization

  • Captures multiple conformational states of the channel

  • Provides insights into gating mechanisms and ligand binding

  • May resolve structures of KCNJ1 in complex with regulatory partners

CRISPR-Cas9 Genome Editing:

  • Enables precise introduction of KCNJ1 mutations in cell lines and animal models

  • Facilitates creation of isogenic cell lines that differ only in KCNJ1 sequence

  • Allows study of mutations in their native genomic context

  • Supports development of more physiologically relevant disease models

Automated Patch-Clamp Technology:

  • Increases throughput of electrophysiological studies

  • Enables systematic screening of compounds modulating KCNJ1 function

  • Improves reproducibility of functional characterization

  • Facilitates comparison across multiple KCNJ1 variants

Computational Prediction Platforms:

  • Tools like Rhapsody integrate evolutionary conservation with structural and dynamic features

  • Enable prioritization of variants for functional studies

  • Predict functional consequences of mutations

  • Validated predictive power for probing potential impact of both known disease-associated and randomly selected KCNJ1 variants

Single-Cell Transcriptomics:

  • Reveals cell-specific expression patterns of KCNJ1 and interacting partners

  • Identifies co-expression networks relevant to channel function

  • Elucidates transcriptional regulation of KCNJ1 in different tissues

  • Maps expression changes in disease states

Microfluidic Organ-on-Chip Technology:

  • Creates physiologically relevant microenvironments for studying KCNJ1 function

  • Enables integration of multiple cell types to mimic tissue architecture

  • Allows manipulation of mechanical forces relevant to channel activation

  • Supports drug screening in more physiological contexts

The integration of these technologies is accelerating our understanding of KCNJ1 structure, function, and role in disease, while opening new avenues for therapeutic development and personalized medicine approaches for KCNJ1-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.