Recombinant Rat ATP synthase protein 8 (Mt-atp8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Mt-atp8; Atp8; Atpase8; Mtatp8; ATP synthase protein 8; A6L; Chargerin II; F-ATPase subunit 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-67
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MPQLDTSTWFITIISSMATLFILFQLKISSQTFPAPPSPKTMATEKTNNPWESKWTKIYLPLSLPPQ
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This protein, part of the complex F(0) domain, is a minor subunit located within the membrane alongside subunit a.
Gene References Into Functions
  1. Abnormal expressions of mtDNA ATPase 6 and ATPase 8 genes lead to disordered mitochondrial energy metabolism during cold preservation and reperfusion injury in rat liver transplantation. PMID: 20450733
Database Links
Protein Families
ATPase protein 8 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is MT-ATP8 and what is its role in ATP synthase complex?

MT-ATP8 is a mitochondrially encoded subunit of ATP synthase located in the membrane-embedded FO domain of the complex. It forms an α-helix that spans the inner mitochondrial membrane and protrudes into the matrix. Unlike subunit a (ATP6), MT-ATP8 is not directly involved in proton transport as it is positioned remote from the c-ring .

The primary function of MT-ATP8 appears to be structural - it is tightly adjusted to subunit a and subunits i/j in the membrane part of the ATP synthase stator. Based on structural analyses, MT-ATP8 serves to stabilize the positioning of subunit a, which is critical for proton transport through the enzyme FO domain .

How conserved is the MT-ATP8 sequence across species?

The primary sequence of MT-ATP8 is not highly conserved across species, even among higher organisms. Only the beginning of the sequence shows significant similarity between species. For example, when comparing human and yeast subunit 8, only the first 4 residues and leucine in position 18 are fully conserved, while similar residues are present in positions 9 and 13 (W9 and I13 in mammals are replaced by F9 and L13 in yeast, respectively) .

Despite the variability in primary sequence, the tertiary structure of the membrane domain of subunit 8 is remarkably preserved across organisms. This structural conservation allows researchers to model substitutions in this region using cross-species comparisons .

How does MT-ATP8 contribute to ATP synthase stability and function?

MT-ATP8 contributes to ATP synthase stability through several key structural interactions:

  • The first six residues of the MT-ATP8 helix are bent at a ninety-degree angle toward subunit a helix 4 (aH4).

  • A conserved threonine in position 6 causes the 8-helix to fold toward the a subunit.

  • The internal hydrogen bond between the side-chain oxygen of threonine-6 with the backbone carbonyl group of leucine in position 4 (8L4) stabilizes the backbone bending of subunit 8 .

  • The neighboring tryptophan (8W9) interacts with aL98 and aS99 in helix 4 of subunit a, further stabilizing its positioning .

These interactions are crucial for maintaining the structural integrity of the ATP synthase complex, particularly the correct positioning of subunit a, which is directly involved in proton transport.

What is the relationship between MT-ATP8 and MT-ATP6 genes?

The MT-ATP8 and MT-ATP6 genes show a 46 nucleotide overlap in the mitochondrial genome . This overlapping arrangement creates a complex genetic situation where mutations in the overlapping region can potentially affect both proteins. When studying MT-ATP8 variants, researchers often limit their analysis to variants in the MT-ATP8 gene fragment specific to subunit 8 only, excluding variants in the region common to both genes to isolate effects specific to MT-ATP8 .

What methodologies are used to study the effects of MT-ATP8 variants on ATP synthase function?

Researchers employ several complementary approaches to study MT-ATP8 variants:

  • Yeast model systems: S. cerevisiae has been successfully used to study the effects of variants in mitochondrially encoded ATP synthase subunits. Researchers introduce mutations equivalent to human MT-ATP8 variants into the yeast ATP8 gene and study their effects both in vivo and in vitro .

  • Biochemical assays: After isolating mitochondria from yeast models expressing mutant ATP8, researchers can measure enzymatic activities and ATP synthesis rates to determine functional consequences of mutations .

  • Structural modeling: Using available ATP synthase structures, researchers perform in silico analysis to predict how specific amino acid substitutions might affect:

    • Total free energy change of the stability of the subunit 8 peptide

    • Stabilization/destabilization effects on pairwise inter-subunit interactions

  • Transgenic mouse models: For more advanced in vivo studies, researchers generate transgenic mice with epitope-tagged recoded mitochondrial-targeted ATP8 genes expressed from nuclear loci (e.g., ROSA26) .

What are the known pathogenic variants in MT-ATP8 and their molecular mechanisms?

Several MT-ATP8 variants have been reported in patients with mitochondrial diseases, as summarized in the table below:

mtDNA variantNumber of casesATP8 amino acid changeAssociated disease/syndromePathogenic scoreDatabase status
8381A>G2T6AMIDD/LVNC cardiomyopathy0.47Reported/benign
8382C>T1T6IEpisodic paralysis0.58Reported/uncertain significance
8403T>C1I13TEpisodic weakness and progressive neuropathy0.77Reported/uncertain significance
8411A>G1M16VSevere mitochondrial disorder0.63Reported/uncertain significance

Molecular mechanisms associated with these variants include:

  • Variants m.8381A>G and m.8382C>T lead to substitution of threonine in position 6 with alanine or isoleucine (8T6A/I), respectively. These substitutions can disrupt the internal hydrogen bond that stabilizes subunit 8 backbone bending, potentially affecting its interaction with subunit a .

  • The m.8403T>C variant (I13T) has been studied using yeast models, where the equivalent substitution (8L13T) was introduced. This position is in the transmembrane domain of subunit 8 that interacts with subunit a .

How can allotopic expression be utilized as a gene therapy approach for MT-ATP8 defects?

Allotopic expression, the re-engineering of mitochondrial genes for expression from the nucleus, represents a promising approach for treating defects arising from mtDNA mutations. The methodology involves:

  • Gene redesign: Creating a codon-optimized version of the MT-ATP8 gene suitable for nuclear expression .

  • Targeting sequence addition: Adding a mitochondrial targeting sequence (MTS), such as that from nuclear-encoded ATP synthase subunit ATP5G1, to facilitate transport of the synthesized protein into mitochondria .

  • Epitope tagging: Adding epitope tags (such as MYC or FLAG) to enable detection and tracking of the recombinant protein .

  • Safe harbor integration: Using techniques like TARGATT homologous recombination to insert a single copy of the construct into a safe harbor locus (e.g., ROSA26) in the nuclear genome .

  • Verification of incorporation: Using animal models with natural polymorphisms in MT-ATP8 to verify successful incorporation of the recombinant protein into the ATP synthase complex .

Research with transgenic mice has demonstrated that allotopically expressed ATP8 can be constitutively expressed across tissues, successfully transported into mitochondria, and incorporated into functional ATP synthase complexes without negative impacts on mitochondrial function, metabolism, or behavior .

How can yeast models be effectively used to study MT-ATP8 variants found in human patients?

Yeast (S. cerevisiae) provides a valuable model system for studying MT-ATP8 variants, despite differences in the primary sequence compared to humans. Key methodological considerations include:

  • Sequence alignment and conservation analysis: Identifying conserved or similar residues between human and yeast ATP8 sequences to determine which human variants can be meaningfully studied in yeast .

  • Structural comparison: Comparing the structures of yeast and mammalian subunit 8 in the context of the whole ATP synthase complex. Despite sequence differences, the first 20 amino acid residues of subunit 8 in vertebrates and yeast have similar structures, validating the use of yeast for studying certain variants .

  • Generation of yeast strains: Creating yeast strains with mutations equivalent to human MT-ATP8 variants. This may involve:

    • Using strains with deletion of the endogenous ATP8 gene (atp8::ARG8m)

    • Introducing plasmids encoding mutant ATP8

  • Functional assays: Measuring the impact of mutations on:

    • Growth phenotypes on different carbon sources

    • ATP synthase assembly and activity

    • Mitochondrial respiration rates

    • ATP synthesis capacity

What experimental approaches can assess the incorporation of recombinant MT-ATP8 into the ATP synthase complex?

Several techniques can be used to verify successful incorporation of recombinant MT-ATP8 into the ATP synthase complex:

  • Immunodetection methods:

    • Western blotting using antibodies against epitope tags (e.g., FLAG or MYC) added to the recombinant protein

    • Co-immunoprecipitation to demonstrate association with other ATP synthase subunits

  • Blue Native PAGE: To visualize intact ATP synthase complexes and confirm incorporation of tagged recombinant MT-ATP8 .

  • Enzymatic activity assays: Measuring ATP synthase activity to verify functional incorporation. Similar activity levels between transgenic and non-transgenic controls suggest successful integration and function of the recombinant protein .

  • Localization studies: Confocal microscopy or subcellular fractionation to confirm mitochondrial localization of the recombinant protein .

  • Mass spectrometry: To identify and quantify both endogenous and recombinant ATP8 within purified ATP synthase complexes.

What are the technical challenges in expressing and purifying recombinant MT-ATP8?

MT-ATP8 presents several technical challenges for recombinant expression and purification:

  • Hydrophobic nature: As a transmembrane protein, MT-ATP8 is highly hydrophobic, making it difficult to express in soluble form and prone to aggregation.

  • Small size: MT-ATP8 is a relatively small protein (approximately 8 kDa), which can complicate detection and purification procedures.

  • Proper folding: Ensuring correct folding of the recombinant protein, particularly when expressed in bacterial systems that lack mitochondria.

  • Mitochondrial targeting: When expressing from the nucleus in eukaryotic systems, the recombinant protein must be correctly targeted to mitochondria using appropriate targeting sequences .

  • Integration into complex: For functional studies, the recombinant protein must be able to integrate into the ATP synthase complex, which requires proper interaction with multiple other subunits.

How can structural data be used to predict the functional consequences of MT-ATP8 variants?

Structural analysis provides valuable insights into the potential consequences of MT-ATP8 variants:

  • Free energy calculations: Researchers can quantify the thermodynamic effects of amino acid substitutions using two classes of descriptors:

    • Total free energy change of the stability of the subunit 8 peptide

    • Stabilization/destabilization effect on pairwise inter-subunit interactions

  • Hydrogen bond analysis: Identifying disruptions to key hydrogen bonds, such as the internal hydrogen bond between threonine-6 and leucine-4 that stabilizes subunit 8 backbone bending .

  • Interface analysis: Examining how substitutions affect interactions between subunit 8 and adjacent subunits, particularly subunit a .

  • Conservation mapping: Mapping variants onto conserved regions to predict functional importance.

  • Molecular dynamics simulations: Simulating the dynamic behavior of wild-type and mutant proteins to predict structural and functional changes over time.

What are the most promising approaches for therapeutic interventions targeting MT-ATP8 defects?

Based on current research, several therapeutic approaches show promise:

  • Allotopic expression: The successful demonstration of allotopic expression of ATP8 in transgenic mice represents a significant step toward utilizing this approach as a gene therapy in humans .

  • CRISPR-based mitochondrial editing: Development of mitochondria-targeted CRISPR systems could enable direct correction of mtDNA mutations.

  • Small molecule modulators: Identification of compounds that can stabilize ATP synthase despite MT-ATP8 defects.

  • Heteroplasmy shifting: Techniques to reduce the proportion of mutated mtDNA relative to wild-type mtDNA.

  • Mitochondrial replacement therapy: For severe MT-ATP8 defects, replacing the entire mitochondrial genome might be necessary.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.