Recombinant Rat B1 bradykinin receptor (Bdkrb1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Rat Bdkrb1 is produced by cloning and expressing the full-length Bdkrb1 gene sequence in heterologous systems. Key structural and biochemical properties include:

PropertyDetails
Gene ID623 (Human homolog); P97583 (Rat Uniprot ID)
Amino Acid Sequence337 residues (full-length), including extracellular, transmembrane, and intracellular domains
Expression RegionResidues 1–337 (entire functional receptor)
Post-Translational ModificationsGlycosylation sites (predicted), disulfide bonds (Cys residues in extracellular loops)
Storage Conditions-20°C in Tris-based buffer with 50% glycerol; stable for ≤1 week at 4°C

The recombinant protein retains ligand-binding specificity for bradykinin fragments (e.g., des-Arg<sup>9</sup>-bradykinin) and exhibits calcium mobilization upon activation .

Applications in Research

Recombinant Bdkrb1 is critical for:

Mechanistic Studies

  • Investigating receptor-ligand interactions using surface plasmon resonance (SPR) or fluorescence polarization assays .

  • Mapping phosphorylation sites involved in GPCR desensitization .

Drug Development

  • Screening antagonists (e.g., LF22-0542) for inflammatory pain .

  • Validating species-specific pharmacodynamics; humanized rodent models show enhanced translational relevance .

Disease Modeling

  • Renal ischemia-reperfusion injury: Bdkrb1 deficiency exacerbates oxidative DNA damage and apoptosis .

  • Diabetic complications: Hyperglycemia-induced vascular permeability and neuropathy involve B1 receptor upregulation .

Role in Pain Pathways

  • Acute vs. Chronic Exposure: Acute bradykinin application increases excitability in human dorsal root ganglion (DRG) neurons, while prolonged exposure reduces responsiveness .

  • Nociceptor Subtypes: BDKRB1 is expressed in medium-to-large DRG neurons (diameter >40 μm), correlating with mechanical hyperalgesia .

Renal Protection

  • Ischemia-Reperfusion Injury: Double-knockout mice (Bdkrb1<sup>−/−</sup>/ Bdkrb2<sup>−/−</sup>) exhibit 3-fold higher mortality and severe tubular necrosis compared to wild-type .

  • Therapeutic Target: B1 receptor agonism reduces TGF-β1 and endothelin-1 overexpression post-injury .

Diabetes-Associated Pathologies

  • Vascular Dysfunction: Streptozotocin-induced diabetic mice show BDKRB1-mediated hyperpermeability and albuminuria .

  • Neutrophil Apoptosis: B1 receptor knockout models display reduced neutrophil accumulation in inflamed tissues .

Technical Considerations

ParameterSpecification
Purity≥90% (SDS-PAGE)
Activity AssayCalcium flux measured via FLIPR in HEK293 cells (EC<sub>50</sub> ~1 nM)
Cross-ReactivityReacts with human, mouse, and rat samples

Challenges and Future Directions

  • Low Basal Expression: Bdkrb1 is undetectable in healthy tissues, necessitating injury models for functional studies .

  • Species Selectivity: Humanized receptor models (e.g., transgenic rats) improve preclinical drug testing .

  • Therapeutic Potential: Dual B1/B2 receptor antagonists may offer superior efficacy in chronic inflammation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Bdkrb1; B1bkr; Bkr; B1 bradykinin receptor; B1R; BK-1 receptor; Kinin B1 receptor; KB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSF FLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLC RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSI PTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLR GQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEIT DLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Uniprot No.

Target Background

Function
This protein is a receptor for bradykinin, potentially playing a role in chronic pain and inflammation.
Gene References Into Functions

References Supporting the Role of the Rat B1 Bradykinin Receptor (Bdkrb1) in Various Physiological and Pathological Processes:

  1. Experimental periodontitis in rats induces systemic inflammation and upregulates B1 kinin receptors in the rat paw, modifying the inflammatory response distally from the oral infection. PMID: 29225113
  2. Endothelial-specific B1R overexpression in rat hearts results in expanded left ventricular cavities, reduced pressure generation capacity, and impaired shortening, suggesting myocardial depression. PMID: 28937259
  3. Upregulated B1R may contribute to early hemorrhagic transformation after cerebral ischemia/reperfusion in type 1 diabetic rats. PMID: 28726167
  4. Data suggest a potential role of B1R in short-term memory impairment observed in traumatic brain injury, neuroinflammation, and neurodegeneration. PMID: 26669247
  5. The kinin B1R contributes to acute gouty attacks, including those facilitated by ACE inhibitors. PMID: 25344431
  6. Kinin B1R is upregulated by oxidative stress in the brains of insulin-resistant rats, and its activation causes nocifensive behavior through the release of substance P, glutamate, and nitric oxide. PMID: 25959537
  7. This study details the preclinical pharmacology, metabolic stability, pharmacokinetics, and toxicology of the peptidic kinin B1 receptor antagonist R-954. PMID: 24361511
  8. B1 bradykinin receptor overexpression upregulates bradykinin B2 receptor expression in vascular endothelium. PMID: 23306173
  9. No significant difference in B1 receptor expression was found between experimental groups; arterial injection of R-715, a B1 receptor blocker, had no significant effects on responses evoked by muscle stretch. PMID: 23417862
  10. Exposure of lung slices to fresh smoke upregulates stress-response genes (bradykinin B1 receptor, IL-1β, and CYP1A1) and damages alveolar structure. PMID: 22266391
  11. The bradykinin B1 receptor antagonist R-954 inhibited edema in rat paws, suggesting involvement of B1 receptors in tumor growth. PMID: 21835216
  12. Kinin B1 receptor enhances oxidative stress in an insulin-resistance rat model. PMID: 20830306
  13. Results demonstrate the involvement of the bradykinin B1 receptor in cigarette smoke-induced airway inflammation, mediated by the pro-inflammatory cytokine IL-1β. PMID: 20637817
  14. Upregulation of the kinin B1R in spinal dorsal horn microglia by pro-inflammatory cytokines is proposed as a crucial mechanism in early pain neuropathy in STZ-diabetic rats. PMID: 20587056
  15. Upregulation of kinin B1 receptor mRNA in the hypothalamus of spontaneously hypertensive rats may reflect an epiphenomenon in essential hypertension. PMID: 12025958
  16. Induction of renal bradykinin B1 receptor expression in streptozotocin-diabetic rats is supported by increased B1 receptor protein and mRNA, and the functional effect of a B1 antagonist on Erk-1 and Erk-2 phosphorylation. PMID: 12025968
  17. Results support an important role for kinin B1 receptors in modulating inflammatory responses and demonstrate that B1 receptors mediate a hypertensive response to des-Arg(9)-bradykinin. PMID: 12411434
  18. Upregulation of the bradykinin B1 receptor in early and chronic stages of cardiac remodeling indicates a major role for kinins in cardiac injury and repair. PMID: 12489796
  19. Kinin B1 receptor is upregulated in the streptozotocin-diabetic rat lung, and its activation increases leukocyte infiltration; B1 receptor overexpression seems to depend on neutrophil influx and hyperglycemia. PMID: 12522068
  20. Kindling-induced epilepsy results in a striking increase of B1 receptor labeling in the rat brain. An altered balance between B1 and B2 receptor populations may play a pivotal role in the onset and/or maintenance of epilepsy. PMID: 12746865
  21. B1 bradykinin receptors expressed in the periphery and spinal cord play a functional role in mechanical hyperalgesia during inflammation. PMID: 12927641
  22. B1 receptors are upregulated during reperfusion, influencing adherent leukocytes; carboxypeptidase M activity is upregulated when receptor ligands are used; located on acinar cell membranes; antagonism of Bdkrb1 decreases survival rate. PMID: 14515994
  23. B1R and B2R signaling show physiological antagonism. B1R signaling suggests involvement in down-regulation of leukocyte activation, transmigration, and homing. PMID: 15001555
  24. Bradykinin B1 receptor expression is upregulated by tissue damage in the portal vein. PMID: 15087417
  25. Renal B1R might be overexpressed in hypertension, playing a role in renal protection by inhibiting renal fibrosis via increased NO production and suppressed TGFβ1 expression. PMID: 15253105
  26. Specific B1 receptor activation causes translocation of the epsilon isoform of protein kinase C to the membrane of sensory neurons. PMID: 15319421
  27. The bradykinin B1 receptor in the heart may attenuate cardiac remodeling via inhibition of MAP kinases and TGF-β1 expression through increased eNOS activity in hypertension. PMID: 16497153
  28. In the 2K-1C rat, cardiac B1 receptor induction might be linked to AT1 receptor activation. PMID: 16822558
  29. Increased densities of kinin B1 and B2 receptors in animals with Aβ infusion were observed in brain regions related to cognitive behavior. PMID: 17570564
  30. Angiotensin II induces B1 receptor expression in the aorta via superoxide anion generation, NADPH oxidase, and NF-κB activation. PMID: 17664391
  31. Oxidative stress contributes to B1R induction and upregulation in glucose-fed insulin resistance models. Overexpressed B1R contributes to arterial hypertension and sensory abnormalities. PMID: 17988733
  32. Antioxidant or ACE inhibitor treatment has beneficial effects on sensory polyneuropathy, hypertension, and insulin resistance in glucose-fed rats, associated with reduced kinin B1 receptor expression. PMID: 18555989
  33. BKR gene deletion prevents cardiac inflammation and fibrosis in experimental diabetic angiopathy. PMID: 19276445
  34. Kinin B1 receptor detection in primary microglial cell culture and on microglial cells, astrocytes, and sensory C fibers in the thoracic spinal cord of STZ-diabetic rats. PMID: 19323833
  35. Tyrosine kinase activity sensitive to AG 1478 is recruited by tissue damage and exogenous EGF to upregulate bradykinin B1 receptors in isolated aortas. PMID: 19374866
Database Links
Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in bladder, lung, duodenum, kidney, uterus, thymus, salivary gland, testis, prostate, macrophages, aorta, spleen and heart.

Q&A

What is the molecular structure and genomic organization of rat Bdkrb1?

The rat Bdkrb1 gene contains two exons with the entire coding region located within the second exon. The gene's 5'-flanking region contains several putative transcriptional regulatory sites including a TATA box, cAMP response element, NF-kappaB, and AP-1 . These regulatory elements are crucial for its inducible expression pattern. The deduced rat B1 receptor amino acid sequence shares 71% homology with human and rabbit counterparts, and 89% homology with the mouse counterpart .

The rat Bdkrb1 mRNA undergoes alternative splicing and can be induced by lipopolysaccharide (LPS) treatment in multiple tissues including salivary gland, testis, kidney, lung, heart, prostate, and aorta . This alternative splicing may contribute to tissue-specific expression patterns and functions of the receptor in different physiological contexts.

How does Bdkrb1 expression differ from Bdkrb2 under normal and pathological conditions?

In contrast to Bdkrb2 (B2 receptor), which shows constitutive and high expression in most tissues except liver and spleen, Bdkrb1 is expressed at low levels in normal tissues but is significantly induced after tissue injury or following exposure to endotoxins or cytokines . Notably, Bdkrb1 expression is markedly upregulated when Bdkrb2 is absent, suggesting a compensatory relationship between these two receptors .

During pathological conditions such as ischemia/reperfusion (I/R) injury, the expression of both receptors increases, but through different mechanisms . Bdkrb1 induction appears to be mediated by inflammatory stimuli, while Bdkrb2 expression changes may involve different regulatory pathways. For instance, in human amnion, both BDKRB1 and BDKRB2 transcripts show increased abundance during term labor compared to non-labor conditions, indicating their role in parturition processes .

What is the ligand binding profile of recombinant rat Bdkrb1?

When expressed in HEK293 cells, recombinant rat Bdkrb1 demonstrates a distinct rank order of affinity for kinin peptides: des-Arg9-BK > Lys-des-Arg9-BK ≈ des-Arg9, Leu8-BK > Sar-Tyr-epsilonAhx-Lys-[D-betaNal7, Ile8]-des-Arg9-BK > Sar-Tyr-epsilonAhx-Lys-des-Arg9-BK >> BK >> Hoe140 . This binding profile confirms that the cloned gene encodes a functional rat B1 receptor with characteristic pharmacological properties.

The preferential binding of des-Arg9-BK over intact bradykinin (BK) is a defining feature of B1 receptors across species. This distinct ligand selectivity profile is essential for researchers designing selective agonists or antagonists targeting Bdkrb1 in experimental models. Understanding these binding characteristics is crucial when interpreting results from functional studies involving bradykinin receptor stimulation.

How can researchers detect and quantify Bdkrb1 expression in rat tissues?

Several methodologies are available for detecting and quantifying Bdkrb1 expression in rat tissues. RT-PCR and quantitative real-time PCR can be employed to measure mRNA levels, as demonstrated in studies showing LPS-induced expression in various tissues . For protein detection, immunohistochemistry and Western blotting with specific antibodies against rat Bdkrb1 are effective techniques.

For quantitative measurement of rat Bdkrb1 protein levels, enzyme-linked immunosorbent assay (ELISA) is a reliable method. Commercially available rat Bdkrb1 ELISA kits utilize a competitive enzyme immunoassay technique where Bdkrb1 from samples competes with a fixed amount of Bdkrb1-HRP conjugate for sites on the anti-Bdkrb1 antibody . The intensity of color measured spectrophotometrically at 450nm is inversely proportional to Bdkrb1 concentration in the sample .

What are the optimal strategies for generating and validating Bdkrb1 knockout or humanized rat models?

Generating Bdkrb1 knockout or humanized rat models requires sophisticated genetic engineering approaches. For knockout models, gene-targeting by homologous recombination can be employed to delete the genomic coding sequence of rat Bdkrb1. This approach was successfully used to generate double knockout mice lacking both Bdkrb1 and Bdkrb2 (B1RB2R-null, Bdkrb1−/−/Bdkrb2−/−) by deleting the genomic region encoding both receptors .

For humanized models, gene-targeting can replace the rat Bdkrb1 coding sequence with the human counterpart. This strategy was implemented in mice where the genomic coding sequence for the endogenous mouse B1R was replaced with that of the human B1R . The resulting humanized mice showed an mRNA expression profile similar to that of the mouse Bdkrb1 in wild-type animals, and tissues isolated from these mice possessed pharmacological properties characteristic of the human B1R .

Validation of these models should include:

  • Genotyping to confirm the desired genetic modification

  • mRNA expression analysis to verify absence of target gene or proper expression of the humanized gene

  • Functional assays to demonstrate altered receptor activity

  • Pharmacological characterization with selective agonists and antagonists

How do Bdkrb1 and Bdkrb2 interact in mediating protection against renal ischemia/reperfusion injury?

Both Bdkrb1 and Bdkrb2 play protective roles in renal ischemia/reperfusion (I/R) injury, though with different mechanisms and potency. Comparative studies using B1RB2R-null, B2R-null, and wild-type mice subjected to bilateral renal artery occlusion revealed that mortality rates, renal histological and functional changes, DNA damage markers (8-hydroxy-2′-deoxyguanosine levels), mtDNA deletions, and apoptotic cells increased progressively in the following order: wild-type < B2R-null < B1RB2R-null mice .

The expression of pro-fibrotic and vasoconstrictive factors (TGF-β1, connective tissue growth factor, and endothelin-1) after I/R injury was also exaggerated in the same order, suggesting that both receptors contribute to renoprotection, with B2R playing a predominant role . This indicates a coordinated but non-redundant function of these receptors in modulating the severity of I/R injury.

Mechanistically, both Bdkrb1 and Bdkrb2 couple with Gq protein and their stimulation activates endothelial NO synthase in the vascular endothelium, which may contribute to their protective effects . The more severe phenotype in double knockout compared to single B2R knockout mice suggests that B1R upregulation partially compensates for B2R absence in renal protection against I/R injury.

What signaling pathways are activated by Bdkrb1 stimulation in different cell types?

Bdkrb1 stimulation activates multiple signaling pathways that vary depending on the cell type. In human amnion fibroblasts, stimulation of Bdkrb1 with des-Arg9-bradykinin (DABK) increases the expression of prostaglandin-endoperoxide synthase 2 (PTGS2), the rate-limiting enzyme in prostaglandin synthesis, leading to enhanced PGE2 production . This effect is mediated through subsequent activation of the p38 and ERK1/2 pathways .

Both Bdkrb1 and Bdkrb2 are coupled with the Gq protein, and their stimulation in vascular endothelium activates endothelial NO synthase . This signaling mechanism contributes to vasodilation and may play a role in the protective effects observed in ischemia/reperfusion injury models.

In inflammatory conditions, Bdkrb1 expression can be induced by lipopolysaccharide (LPS) and serum amyloid A1 (SAA1) through toll-like receptor 4 (TLR4) . This induction enhances the cellular responsiveness to Bdkrb1 agonists, creating a feed-forward mechanism that may amplify inflammatory responses. The cell-type specific differences in signaling cascade activation contribute to the diverse physiological and pathological roles of Bdkrb1.

How can recombinant rat Bdkrb1 be effectively expressed and purified for structural and functional studies?

Expression and purification of recombinant rat Bdkrb1 for structural and functional studies presents significant challenges due to its nature as a G protein-coupled receptor (GPCR) with multiple transmembrane domains. Effective strategies include:

  • Expression Systems: Heterologous expression in mammalian cell lines (e.g., HEK293) has been successfully employed for functional studies of rat Bdkrb1 . For larger-scale protein production, insect cell expression systems (Sf9, High Five) using baculovirus vectors may provide higher yields while maintaining proper protein folding.

  • Fusion Tags and Modifications: Incorporating N- or C-terminal tags (His, FLAG, or MBP) facilitates purification while potentially enhancing stability. For crystallization studies, insertion of a stabilizing protein (e.g., T4 lysozyme) in an intracellular loop or fusion with a stabilizing interaction partner may be necessary.

  • Solubilization and Purification: Careful selection of detergents (e.g., DDM, LMNG) or lipid nanodiscs is crucial for maintaining receptor structure during extraction from membranes. Affinity chromatography followed by size exclusion chromatography can achieve high purity.

  • Functional Validation: Ligand binding assays using labeled des-Arg9-BK or competitive binding assays should be performed to confirm that the purified receptor retains its characteristic pharmacological profile with the rank order of affinity: des-Arg9-BK > Lys-des-Arg9-BK ≈ des-Arg9, Leu8-BK .

Structural characterization may be achieved through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy, depending on the quantity and quality of the purified protein.

What role does Bdkrb1 play in inflammatory processes and how can this be modulated experimentally?

Bdkrb1 plays a significant role in inflammatory processes, with its expression markedly increased following tissue injury or exposure to inflammatory mediators. In contrast to the constitutively expressed Bdkrb2, Bdkrb1 is induced during inflammation, creating a positive feedback loop that amplifies inflammatory responses .

Experimentally, Bdkrb1-mediated inflammation can be modulated through several approaches:

  • Pharmacological Modulation: Selective Bdkrb1 antagonists, such as des-Arg9-HOE140, can inhibit receptor activation. Antagonists of Bdkrb1 offer promise as novel therapeutic agents for inflammatory and neuropathic pain .

  • Genetic Approaches: Knockout models lacking Bdkrb1, or both Bdkrb1 and Bdkrb2, provide valuable tools for studying the role of these receptors in inflammatory conditions . Humanized models expressing human Bdkrb1 in place of rodent receptors enable testing of human-selective compounds in animal models .

  • Signaling Pathway Inhibition: Targeting downstream signaling components, such as p38 and ERK1/2 MAPK pathways, can attenuate Bdkrb1-mediated inflammatory responses .

  • Induction and Inhibition of Expression: LPS and inflammatory cytokines induce Bdkrb1 expression through transcription factors like NF-κB . Inhibitors of these pathways can suppress Bdkrb1 upregulation and subsequent inflammatory cascade activation.

In human amnion fibroblasts, both LPS and serum amyloid A1 (SAA1) induce the expression of Bdkrb1 through toll-like receptor 4 (TLR4), enhancing the cells' responsiveness to bradykinin peptides and subsequent production of prostaglandins . This mechanism represents a potential target for modulating inflammation in specific tissues.

How do species differences in Bdkrb1 affect experimental design and translation of findings?

Significant species differences exist in Bdkrb1 structure and pharmacology, presenting challenges for experimental design and translation of findings. The rat Bdkrb1 amino acid sequence shares only 71% homology with human and rabbit counterparts, though it has higher (89%) homology with the mouse counterpart . These sequence differences translate into species-specific pharmacological properties, particularly regarding ligand binding profiles and antagonist selectivity.

Many compounds exhibit profound species selectivity for Bdkrb1, making it difficult to translate findings from rodent models to human applications . This species selectivity necessitates careful consideration when selecting compounds for in vivo studies and when interpreting results for potential clinical applications.

To overcome these limitations, humanized animal models expressing human Bdkrb1 have been developed . These models allow for testing human B1R-selective compounds in vivo while maintaining the physiological context of a living organism. In a transgenic rat model overexpressing the human B1R under the control of the neuronal-specific enolase promoter, researchers were able to assess human B1R receptor occupancy in the central nervous system .

For experimental design, researchers should:

  • Consider species-specific pharmacological properties when selecting agonists/antagonists

  • Use humanized models when testing human-selective compounds

  • Validate findings across multiple species when possible

  • Exercise caution when extrapolating from animal models to human conditions

What is the relationship between Bdkrb1 and other inflammatory mediators in disease models?

The relationship between Bdkrb1 and other inflammatory mediators is complex and bidirectional. Inflammatory stimuli induce Bdkrb1 expression, and activated Bdkrb1 in turn enhances the production of additional inflammatory mediators:

  • Induction of Bdkrb1: Lipopolysaccharide (LPS) and inflammatory cytokines induce Bdkrb1 expression through activation of transcription factors like NF-κB . In human amnion fibroblasts, both LPS and serum amyloid A1 (SAA1) induce the expression of Bdkrb1 through toll-like receptor 4 (TLR4) .

  • Bdkrb1-Mediated Inflammatory Responses: Activated Bdkrb1 increases the expression of prostaglandin-endoperoxide synthase 2 (PTGS2) and subsequent PGE2 production through p38 and ERK1/2 pathways . This contributes to the amplification of inflammatory responses.

  • Interaction with Profibrotic Mediators: In renal ischemia/reperfusion injury, Bdkrb1 and Bdkrb2 deficiency leads to increased expression of profibrotic factors such as TGF-β1, connective tissue growth factor (CTGF), and endothelin-1 (ET-1) . This suggests that bradykinin receptors normally suppress these mediators, limiting tissue fibrosis.

The table below summarizes key interactions between Bdkrb1 and other inflammatory mediators:

Inflammatory MediatorEffect on Bdkrb1Effect of Bdkrb1 ActivationDisease Context
Lipopolysaccharide (LPS)Induces expression-Various inflammatory conditions
Serum Amyloid A1 (SAA1)Induces expression-Parturition, inflammation
TGF-β1-Suppression (indirect)Renal I/R injury
CTGF-Suppression (indirect)Renal I/R injury
Endothelin-1-Suppression (indirect)Renal I/R injury
Prostaglandins (via PTGS2)-EnhancementParturition, inflammation

Understanding these interactions is crucial for developing targeted interventions in inflammatory and fibrotic diseases where Bdkrb1 plays a significant role.

How can Bdkrb1-targeted approaches be applied in preclinical models of pain and inflammation?

Bdkrb1-targeted approaches offer promising strategies for treating pain and inflammation in preclinical models. Antagonists of Bdkrb1 have shown potential as novel therapeutic agents for inflammatory and neuropathic pain . Several methodologies can be employed to leverage Bdkrb1 as a target:

  • Selective Antagonists: Development and testing of selective Bdkrb1 antagonists in rodent models of inflammatory and neuropathic pain. The species selectivity of these compounds necessitates careful consideration, potentially using humanized models for testing human-selective compounds .

  • Humanized Animal Models: Transgenic rats expressing human Bdkrb1 under tissue-specific promoters (e.g., neuronal-specific enolase) allow for assessing human Bdkrb1 receptor occupancy in relevant tissues like the central nervous system . These models overcome the species barrier in preclinical studies.

  • Dual Targeting Approaches: Given the complementary roles of Bdkrb1 and Bdkrb2 in inflammatory processes, strategies targeting both receptors or their common signaling pathways might provide enhanced therapeutic effects compared to targeting either receptor alone .

  • Combination with Anti-inflammatory Agents: Bdkrb1 antagonists could potentially synergize with other anti-inflammatory or analgesic agents. For instance, combining Bdkrb1 antagonists with inhibitors of prostaglandin synthesis might provide enhanced pain relief in models where both kinins and prostaglandins contribute to nociception .

  • Expression Regulation: Approaches targeting the induction of Bdkrb1 expression, such as inhibitors of NF-κB or other transcription factors involved in its upregulation, could prevent the amplification of inflammatory responses mediated by this receptor .

In models of renal ischemia/reperfusion injury, Bdkrb1 activation appears protective rather than detrimental , highlighting the context-dependent role of this receptor. This emphasizes the importance of carefully characterizing the role of Bdkrb1 in each specific disease model before developing targeted therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.