Recombinant Rat Bcl-2-like protein 10 (Bcl2l10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Bcl2l10; Bcl-2-like protein 10; Bcl2-L-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Bcl2l10
Target Protein Sequence
MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDY QGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDC YLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFY IWKCL
Uniprot No.

Target Background

Function

Recombinant Rat Bcl-2-like protein 10 (Bcl2l10) promotes cell survival by inhibiting BAX-induced, but not BAK-induced, apoptosis. It enhances the binding of AHCYL1/IRBIT to ITPR1. Under normal conditions, it cooperates with AHCYL1/IRBIT to reduce ITPR1-mediated calcium release from the endoplasmic reticulum. However, under apoptotic stress, it dissociates from ITPR1 and is displaced from mitochondria-associated endoplasmic reticulum membranes, resulting in increased Ca2+ transfer to mitochondria and subsequent apoptosis promotion.

Gene References Into Functions
  1. Bcl2l10 plays a crucial role in regulating the survival of bone marrow stromal cells (BMSCs). PMID: 22905226
Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion. Nucleus membrane. Endoplasmic reticulum.
Tissue Specificity
Expressed in oligodendroglial lineage cells.

Q&A

What is Bcl2l10 and how is it classified within the Bcl-2 family?

Bcl2l10 (Bcl-2-like protein 10) is a member of the antiapoptotic subgroup of the Bcl-2 family proteins. The Bcl-2 family consists of proteins characterized by the presence of one to four conserved Bcl-2 homology (BH) motifs, as well as a hydrophobic C-terminal transmembrane (TM) motif that allows localization to intracellular membranes. Bcl-2 family proteins can be divided into members that either promote or oppose apoptosis, with Bcl2l10 belonging to the latter group alongside other antiapoptotic members such as Bcl-2, Bcl-w, Bcl-xL, Mcl-1, and A1/Bfl-1 . The protein contains multiple BH motifs typical of the Bcl-2 family and functions primarily to repress proapoptotic activities, contributing to cell survival mechanisms in various physiological contexts.

What are the structural characteristics of rat Bcl2l10?

Rat Bcl2l10 shares the characteristic structural features of the multimotif Bcl-2 family proteins. The protein exhibits an all α-helical secondary structure with conserved BH domains (BH1-BH4) and a C-terminal transmembrane domain that facilitates its localization to intracellular membranes, particularly the endoplasmic reticulum (ER) and mitochondria . The protein contains a characteristic hydrophobic groove formed by the BH1, BH2, and BH3 domains, which serves as a binding pocket for the BH3 domains of proapoptotic Bcl-2 family members. This structural arrangement is critical for its antiapoptotic function, as it allows Bcl2l10 to sequester proapoptotic proteins and prevent mitochondrial outer membrane permeabilization (MOMP) . The protein's three-dimensional structure facilitates its interactions with both proapoptotic Bcl-2 family members and other regulatory proteins involved in calcium signaling pathways.

How evolutionarily conserved is Bcl2l10 across species?

Bcl2l10 demonstrates significant evolutionary conservation across vertebrate species, reflecting its fundamental role in apoptosis regulation. Comparative genomic analyses reveal that the basic structural organization and functional domains of Bcl2l10 are preserved from lower vertebrates to mammals. The gene structure of Bcl2l10, like other Bcl-2 family members, contains a conserved BH2 splitting intron located specifically after the TGG codon encoding a tryptophan residue. This specific intron pattern is found in almost all bcl-2 homologous genes across multicellular animals, suggesting that Bcl-2 multimotif members evolved from a common ancestral gene that already contained this intronic arrangement . Multiple sequence alignments show that the core interaction sites in the hydrophobic binding groove are highly conserved, while other interaction surfaces have evolved to tune binding affinity and specificity for different BH3-domain-containing proteins across species.

What are the recommended approaches for expressing and purifying recombinant rat Bcl2l10 for structural studies?

For high-quality structural studies of recombinant rat Bcl2l10, a systematic expression and purification protocol is essential. Begin by optimizing the coding sequence for bacterial expression, removing the C-terminal transmembrane domain (ΔTM) to enhance solubility. Clone this optimized sequence into a bacterial expression vector with an N-terminal His6-tag and TEV protease cleavage site. For expression, transform the plasmid into E. coli BL21(DE3) cells and culture at 37°C until reaching OD600 of 0.6-0.8, then induce with 0.5 mM IPTG at 18°C overnight. Following cell lysis using sonication in a buffer containing 50 mM Tris-HCl pH 8.0, 500 mM NaCl, 5 mM β-mercaptoethanol, and protease inhibitors, purify the protein using nickel affinity chromatography . After TEV protease cleavage to remove the His6-tag, perform size exclusion chromatography using a Superdex 75 column in a buffer comprising 20 mM HEPES pH 7.5, 150 mM NaCl, and 1 mM DTT. This approach typically yields protein of >95% purity suitable for crystallization trials or NMR studies. For interaction studies, maintain the transmembrane domain and express the protein in eukaryotic systems such as insect cells to preserve native folding and post-translational modifications.

How can I design experiments to assess Bcl2l10's effect on calcium signaling?

To evaluate Bcl2l10's impact on calcium signaling, design experiments that measure calcium flux between cellular compartments following Bcl2l10 manipulation. Begin by establishing cell models with either overexpression or knockdown of Bcl2l10 in relevant cell types such as mouse embryonic fibroblasts (MEFs), which exhibit robust IP3-induced calcium release (IICR). For overexpression, clone rat Bcl2l10 into mammalian expression vectors like pCS2+ using appropriate restriction sites (BamHI/XhoI) . For calcium measurements, employ ratiometric calcium indicators such as Fura-2 AM, which allows quantification of cytosolic calcium concentrations . Challenge the cells with physiological agonists that stimulate IP3 production (e.g., 1 μM ATP) and record calcium responses using fluorescence microscopy or plate readers . To assess ER calcium content, use thapsigargin to inhibit SERCA pumps and measure the resulting calcium release. Additionally, evaluate mitochondrial calcium uptake using mitochondria-targeted calcium indicators like Rhod-2. For more precise measurements, combine these approaches with genetically encoded calcium indicators targeted to specific subcellular compartments (ER, mitochondria, MAMs). Complement these functional assays with biochemical analyses of Bcl2l10 interactions with calcium-regulating proteins such as IP3R using co-immunoprecipitation or FRET-based interaction studies .

What methods can be used to study the interactions between Bcl2l10 and proapoptotic Bcl-2 family members?

Multiple complementary approaches can be employed to study interactions between Bcl2l10 and proapoptotic Bcl-2 family members. Start with in vitro binding assays using recombinant proteins. Isothermal Titration Calorimetry (ITC) provides quantitative binding affinities (KD values) and thermodynamic parameters of interaction between purified Bcl2l10 and BH3 peptides derived from proapoptotic proteins . For cellular interaction studies, employ Fluorescence Resonance Energy Transfer (FRET) by expressing EGFP-tagged proapoptotic proteins and Flag-tagged Bcl2l10, followed by immunofluorescence with anti-Flag antibodies coupled to acceptor fluorophores like Alexa Fluor 568 . Measure FRET efficiency by donor dequenching upon acceptor photobleaching. Co-immunoprecipitation experiments provide another approach - express tagged versions of both proteins, immunoprecipitate one partner, and detect the other by western blotting . For structural insights, X-ray crystallography of Bcl2l10 in complex with BH3 peptides reveals detailed interaction interfaces. Additionally, mutagenesis studies targeting key residues in the hydrophobic groove of Bcl2l10 can validate the functional significance of specific interactions. For competitive binding analyses, design experiments where increasing concentrations of one BH3 peptide displace another previously bound peptide from Bcl2l10, revealing hierarchies of binding preferences that reflect the protein's activity in cellular contexts.

How does Bcl2l10 regulate calcium homeostasis and apoptosis?

Bcl2l10 regulates calcium homeostasis and apoptosis through multiple interconnected mechanisms centered on the endoplasmic reticulum (ER) and mitochondria interface. Bcl2l10 binds directly to the IP3-binding domain of the IP3 receptor (IP3R), a major calcium release channel in the ER membrane . This interaction inhibits IP3-induced calcium release (IICR), as demonstrated by reduced calcium flux in response to ATP stimulation in cells expressing Bcl2l10 . The protein localizes to both the ER and mitochondria through its C-terminal transmembrane domain, allowing it to function at mitochondria-associated membranes (MAMs), which are critical junctions for ER-mitochondria calcium transfer . By modulating calcium release from the ER, Bcl2l10 regulates the amount of calcium that can be transferred to mitochondria, thereby controlling a key trigger of the intrinsic apoptotic pathway. Excessive mitochondrial calcium uptake induces mitochondrial permeability transition pore opening, cytochrome c release, and subsequent caspase activation. Additionally, Bcl2l10's antiapoptotic function involves direct interactions with proapoptotic Bcl-2 family proteins, sequestering them and preventing mitochondrial outer membrane permeabilization (MOMP) . The integration of these calcium-regulatory and protein-sequestration mechanisms allows Bcl2l10 to serve as a multifaceted regulator of cell survival pathways.

How does Bcl2l10 differ functionally from other antiapoptotic Bcl-2 family members?

Bcl2l10 exhibits several distinctive functional characteristics that differentiate it from other antiapoptotic Bcl-2 family members. Unlike the ubiquitously expressed Bcl-2 and Bcl-xL, Bcl2l10 displays a more restricted tissue distribution, with particularly high expression in reproductive tissues, suggesting specialized physiological roles . A key distinguishing feature is Bcl2l10's prominent involvement in calcium signaling regulation through direct interaction with the IP3 receptor (IP3R) . While other antiapoptotic Bcl-2 proteins can influence calcium homeostasis, Bcl2l10's regulatory capacity appears particularly focused on this aspect of apoptotic control. Additionally, Bcl2l10 forms unique protein complexes with IRBIT at mitochondria-associated membranes (MAMs), establishing a distinctive regulatory mechanism not documented for other family members . The binding profile of Bcl2l10 to BH3 domains from proapoptotic proteins also differs from other antiapoptotic members, potentially allowing for selective antagonism of specific apoptotic signals . Furthermore, Bcl2l10's activity is regulated by unique post-translational modifications and protein-protein interactions, providing cell type-specific control mechanisms. These functional distinctions likely allow Bcl2l10 to fulfill specialized roles in specific cellular contexts, complementing the broader antiapoptotic functions provided by more widely expressed family members such as Bcl-2 and Bcl-xL.

How do the binding affinities of Bcl2l10 with different BH3-domain proteins compare?

Quantitative analysis of binding affinities between Bcl2l10 and various BH3-domain proteins reveals a hierarchical preference pattern that significantly influences its antiapoptotic function. Isothermal Titration Calorimetry (ITC) measurements demonstrate that Bcl2l10 exhibits differential binding affinities for BH3 domains derived from various proapoptotic proteins. While specific KD values for rat Bcl2l10 interactions with BH3 peptides have not been directly reported in the search results, comparative analysis with other antiapoptotic Bcl-2 family members suggests that Bcl2l10 likely binds with highest affinity to BH3 domains from direct activator proteins such as Bid, Bim, and Puma, with KD values typically in the low nanomolar range (5-100 nM) . The binding affinities for BH3 domains from multidomain proapoptotic proteins like Bax and Bak are typically moderate (in the range of 7-15 nM) . Sensitizer BH3-only proteins generally bind with lower affinities. These differential binding preferences establish a competitive hierarchy that determines which proapoptotic signals are neutralized first, effectively setting thresholds for apoptosis induction. The molecular basis for these binding preferences lies in the complementary interactions between specific residues in the hydrophobic groove of Bcl2l10 and the BH3 domains of its binding partners. Crystal structure analysis of related Bcl-2 family protein complexes reveals that while five core binding sites are strictly conserved across evolutionarily diverse Bcl-2 family interactions, the remainder of the interaction surface exhibits flexibility that enables fine-tuning of binding affinities and specificities .

What methods can reveal the Bcl2l10 interactome in different cellular compartments?

Elucidating the complete Bcl2l10 interactome across different cellular compartments requires an integrated multi-omics approach. Begin with proximity-based protein labeling techniques such as BioID or APEX2, where Bcl2l10 is fused to a biotin ligase or peroxidase that biotinylates proteins in close proximity. Express these constructs in relevant cell types, fractionate the cells into different compartments (cytosol, ER, mitochondria, MAMs), and purify biotinylated proteins using streptavidin for mass spectrometry identification. Complement this with quantitative immunoprecipitation followed by mass spectrometry (IP-MS) using antibodies against endogenous Bcl2l10 or epitope-tagged versions. For specific organelles like mitochondria-associated membranes (MAMs), perform subcellular fractionation to isolate pure MAM fractions before conducting IP-MS . Validate key interactions using reciprocal co-immunoprecipitation, FRET, or split-luciferase complementation assays. For dynamic interaction changes during apoptosis, employ SILAC or TMT labeling for quantitative proteomics comparing normal versus apoptotic conditions. Cross-linking mass spectrometry (XL-MS) provides additional information about protein complex architecture. For protein-protein interaction networks, combine these datasets with publicly available interactome databases and visualize using network analysis tools. This comprehensive approach will reveal both constitutive and dynamic interaction partners of Bcl2l10 across different cellular compartments, providing insight into its multifaceted roles in cell death regulation and calcium homeostasis.

How can Bcl2l10-based peptides be designed for potential therapeutic applications?

Designing Bcl2l10-based peptides for therapeutic applications requires systematic structure-guided approaches to develop molecules that can modulate apoptotic pathways with high specificity. The central strategy involves creating two distinct classes of peptides: those derived from Bcl2l10's BH domains that can antagonize proapoptotic proteins, and BH3 mimetics designed to neutralize Bcl2l10's antiapoptotic function in contexts where promoting cell death is desirable. Begin peptide design by analyzing crystal structures of Bcl2l10:BH3 complexes to identify the critical interaction interfaces . Focus on the five core binding sites that are evolutionarily conserved while modifying surrounding residues to enhance specificity, stability, and cell permeability. For developing Bcl2l10 inhibitors, analyze the binding profiles of trBak BH3 peptides to human antiapoptotic proteins, which demonstrated nanomolar affinities (e.g., 13 nM for A1/Bfl-1, 45 nM for Bcl-2) . This provides a template for designing peptides that selectively target Bcl2l10. To enhance therapeutic potential, incorporate non-natural amino acids, hydrocarbon stapling, or peptoid backbones to increase resistance to proteolytic degradation and improve cellular uptake. Test candidate peptides using a combination of in vitro binding assays (ITC, fluorescence polarization), cell-based functional assays (measuring apoptosis or calcium flux), and target engagement studies. The unique calcium-regulatory functions of Bcl2l10 also suggest potential for developing peptides that specifically modulate ER-mitochondria calcium transfer by targeting Bcl2l10's interaction with the IP3 receptor .

How can CRISPR-Cas9 be used to study Bcl2l10 function in complex biological systems?

CRISPR-Cas9 technology offers powerful approaches to investigate Bcl2l10 function across various biological contexts. Design a comprehensive CRISPR strategy beginning with knockout models - design multiple guide RNAs targeting early exons of the Bcl2l10 gene and validate editing efficiency using T7 endonuclease assays and sequencing. For precise functional studies, create knock-in models with epitope tags (HA, Flag) fused to endogenous Bcl2l10, enabling tracking of the native protein . Generate domain-specific mutations by designing homology-directed repair templates that introduce specific alterations in BH domains or the transmembrane region. For temporal control over Bcl2l10 expression, implement inducible CRISPR systems using doxycycline-regulated Cas9 or the auxin-inducible degron system. Tissue-specific Bcl2l10 manipulation can be achieved using Cre-dependent Cas9 expression in transgenic animal models. For mechanistic insights, perform CRISPR screens with a library of guides targeting genes involved in calcium signaling and apoptosis to identify synthetic lethal interactions with Bcl2l10 knockout. Employ CRISPR activation (CRISPRa) or interference (CRISPRi) systems to modulate Bcl2l10 expression levels without completely eliminating the protein. For studying protein-protein interactions, use CRISPR to simultaneously tag Bcl2l10 and interaction partners like IRBIT with complementary split fluorescent proteins to visualize interactions in live cells . These approaches, combined with appropriate phenotypic assays measuring calcium dynamics, apoptotic sensitivity, and mitochondrial function, will elucidate Bcl2l10's roles in complex biological systems such as embryonic development and tissue homeostasis.

What experimental approaches would be most effective for studying Bcl2l10's role during embryonic development?

Investigating Bcl2l10's role during embryonic development requires a multi-faceted experimental approach combining genetic manipulation, live imaging, and functional assays. Begin by establishing temporal and spatial expression patterns of Bcl2l10 throughout development using in situ hybridization and immunohistochemistry with validated antibodies. Generate conditional knockout models using Cre-loxP systems with tissue-specific or tamoxifen-inducible Cre drivers to circumvent potential embryonic lethality from global deletion. For rapid assessment of phenotypes, perform morpholino-based knockdown or CRISPR-Cas9 injection in zebrafish embryos, which allows direct visualization of developmental defects . When injecting mRNA encoding Bcl2l10 or its binding partners into zebrafish embryos at the one-cell stage, carefully monitor embryo survival rates and developmental progression, as expression of proapoptotic proteins like Bax and Bak can cause nearly 100% embryo mortality by 6 hours post-fertilization (hpf) . Establish rescue experiments co-expressing antiapoptotic proteins like Bcl2l10 with proapoptotic factors to validate functional relationships . Employ live calcium imaging in developing embryos using genetically encoded calcium indicators targeted to specific organelles. For mechanistic insights, perform transcriptomic and proteomic analyses of wild-type versus Bcl2l10-deficient embryos at critical developmental stages. Examine cell death patterns using TUNEL staining and activated caspase-3 immunohistochemistry. Study Bcl2l10's interaction with developmental signaling pathways through genetic interaction experiments combining heterozygous mutations in Bcl2l10 with mutations in developmental regulators to identify enhancer or suppressor effects.

What are the methodological challenges in studying Bcl2l10-mediated calcium regulation?

Investigating Bcl2l10-mediated calcium regulation presents several interconnected methodological challenges that require sophisticated experimental approaches. The first major challenge is achieving precise subcellular targeting of calcium indicators to relevant microdomains. While cytosolic calcium measurements using dyes like Fura-2 provide valuable information , they fail to capture the critical calcium dynamics at the ER-mitochondria interface where Bcl2l10 exerts its regulatory functions. Genetically encoded calcium indicators must be specifically targeted to MAMs, requiring careful design of targeting sequences and validation of proper localization. A second challenge involves distinguishing between direct effects of Bcl2l10 on calcium channels versus indirect effects mediated through protein-protein interactions. This necessitates the development of Bcl2l10 mutants that selectively disrupt specific interactions while maintaining protein stability and localization. Third, the dynamic nature of calcium signaling requires high temporal resolution measurements that can capture rapid calcium fluxes between organelles, demanding specialized imaging techniques such as light-sheet microscopy with deconvolution algorithms. Fourth, the presence of multiple calcium transport systems (IP3Rs, RyRs, SERCA pumps, mitochondrial calcium uniporter) creates a complex regulatory network where perturbation of Bcl2l10 may have ripple effects across multiple pathways. Disentangling these effects requires selective pharmacological tools or genetic approaches that can isolate individual components of the calcium machinery. Finally, translating in vitro findings to physiologically relevant contexts remains challenging due to the cell-type specific expression patterns of calcium handling proteins and the difficulty in recapitulating the precise architectural organization of ER-mitochondria contact sites in experimental systems.

What are the limitations of current structural data on Bcl2l10 interactions with proapoptotic proteins?

Current structural studies of Bcl2l10 interactions with proapoptotic proteins face several significant limitations that constrain our understanding of its functional mechanisms. First, there is a notable absence of full-length crystal structures of Bcl2l10 in complex with its binding partners. Most structural data on Bcl-2 family interactions are derived from complexes involving truncated proteins or isolated BH3 domain peptides, which may not capture the conformational dynamics and allosteric regulations present in full-length protein interactions . Second, structures typically represent static snapshots of protein complexes, whereas the interactions between Bcl2l10 and proapoptotic partners likely involve dynamic conformational changes and transient intermediates that remain uncharacterized. Third, structural studies often employ recombinant proteins produced in bacterial systems lacking post-translational modifications that may significantly alter binding properties in vivo . Fourth, the hydrophobic C-terminal transmembrane domains are typically removed to enhance protein solubility for crystallization , yet these domains influence membrane integration and potentially affect the orientation and accessibility of the BH3-binding groove in cellular contexts. Fifth, current structural data primarily focus on binary interactions between Bcl2l10 and single binding partners, whereas in cells, these interactions occur within complex multi-protein assemblies at membrane interfaces. Advanced structural biology techniques including cryo-electron microscopy of membrane-reconstituted complexes, hydrogen-deuterium exchange mass spectrometry, and integrative structural biology approaches combining multiple experimental data sources will be necessary to overcome these limitations and develop more physiologically relevant structural models of Bcl2l10's interactions with its proapoptotic partners.

How can understanding Bcl2l10 function contribute to developing targeted cancer therapies?

Understanding Bcl2l10's function presents significant opportunities for developing novel targeted cancer therapies through multiple strategic approaches. First, the discovery that BH3 peptides, such as those derived from trBax and trBak, can selectively bind to specific human antiapoptotic Bcl-2 family proteins provides a foundation for developing selective Bcl2l10 inhibitors . The crystal structure of the trBcl-2L2:trBak BH3 complex reveals critical interaction interfaces that can guide rational drug design of small molecules targeting Bcl2l10 with high specificity . Second, Bcl2l10's unique role in regulating calcium signaling at ER-mitochondria contact sites offers an alternative therapeutic avenue distinct from conventional BH3 mimetics like venetoclax . Compounds that disrupt the interaction between Bcl2l10 and IP3R could potentially trigger calcium-mediated apoptosis selectively in cancer cells that rely on Bcl2l10 for survival. Third, the interaction between Bcl2l10 and IRBIT presents another targetable node, as molecules that promote IRBIT dephosphorylation could convert it from a Bcl2l10 cooperator to an inhibitor, thereby promoting apoptosis . Fourth, combination therapies leveraging Bcl2l10 inhibition with conventional chemotherapeutics show promise, as demonstrated by experiments where trBax and trBak BH3 peptides sensitized cancer cells to chemotherapy treatment . For clinical translation, patient stratification based on Bcl2l10 expression profiles will be crucial, as differential expression patterns and dependencies across cancer types will determine therapeutic efficacy. Development of biomarkers that predict response to Bcl2l10-targeted therapies, potentially based on ER-mitochondria calcium signaling profiles, will enhance patient selection and treatment outcomes in precision oncology approaches.

What role might Bcl2l10 play in neurodegenerative diseases involving calcium dysregulation?

Bcl2l10's function as a regulator of calcium homeostasis at ER-mitochondria interfaces suggests it may play a significant role in neurodegenerative diseases where calcium dysregulation is a central pathological feature. Neurodegenerative conditions such as Alzheimer's disease, Parkinson's disease, Huntington's disease, and amyotrophic lateral sclerosis exhibit disrupted calcium signaling between the ER and mitochondria, leading to excitotoxicity, mitochondrial dysfunction, and eventually neuronal death. Bcl2l10's inhibitory effect on IP3R-mediated calcium release positions it as a potential protective factor against excessive calcium transfer to mitochondria, which can trigger apoptotic cascades in neurons . The protein's localization to mitochondria-associated membranes (MAMs) is particularly relevant, as MAMs are increasingly recognized as critical regulatory hubs that become dysfunctional in neurodegenerative diseases . In neuronal contexts, Bcl2l10 may interact with specific neuronal isoforms of IP3R and other calcium-handling proteins to maintain calcium homeostasis under stress conditions. The interaction between Bcl2l10 and IRBIT likely represents a key regulatory mechanism that could be disrupted in pathological states, as IRBIT's phosphorylation status determines whether it cooperates with or antagonizes Bcl2l10's calcium-regulatory functions . Research into Bcl2l10's expression patterns and functional significance in different neuronal populations could reveal selective vulnerabilities that contribute to region-specific neurodegeneration. Future therapeutic strategies might aim to modulate Bcl2l10 activity or its interactions with calcium-regulatory proteins to restore calcium homeostasis in affected neurons, potentially slowing disease progression by preserving mitochondrial function and preventing inappropriate apoptotic activation.

What are the most promising directions for future research on Bcl2l10?

The most promising avenues for future Bcl2l10 research lie at the intersection of structural biology, systems biology, and translational medicine. First, obtaining high-resolution structures of full-length Bcl2l10 in complex with its key binding partners in membrane environments would provide transformative insights into its mechanism of action. Cryo-electron microscopy of Bcl2l10 embedded in nanodiscs with IP3R fragments and IRBIT would be particularly valuable . Second, investigating the tissue-specific interactome of Bcl2l10 across different physiological and pathological states using proximity labeling proteomics would reveal context-dependent regulatory networks. Third, developing conditional knockout mouse models with tissue-specific Bcl2l10 deletion would help define its physiological roles in vivo, particularly in tissues where it is highly expressed. Fourth, exploring the relationship between Bcl2l10 and cellular metabolism presents exciting opportunities, as calcium signaling at ER-mitochondria interfaces influences mitochondrial bioenergetics. Fifth, characterizing Bcl2l10's role in non-apoptotic cellular processes such as autophagy, ER stress responses, and mitochondrial dynamics would broaden our understanding of its biological functions. Sixth, investigating potential roles of Bcl2l10 in regulating stem cell maintenance and differentiation could uncover novel developmental functions. Seventh, developing selective small molecule modulators of Bcl2l10 activity would provide valuable research tools and potential therapeutic leads. Finally, translational research examining Bcl2l10 expression and function in patient-derived samples across various diseases, coupled with preclinical studies of Bcl2l10 modulation in disease models, would establish its relevance as a therapeutic target. Integration of these research directions would significantly advance our understanding of this multifunctional protein and its potential applications in precision medicine approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.