Recombinant Rat Bcl-2-like protein 1 (Bcl2l1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Bcl-2-like Protein 1 (Bcl2l1)

Bcl-2-like protein 1 (Bcl2l1), also known as Bcl-xL, is a member of the Bcl-2 family of proteins that regulate apoptosis, or programmed cell death . Specifically, Bcl2l1 functions as an anti-apoptotic protein, preventing cells from undergoing apoptosis and thus promoting cell survival . Recombinant Rat Bcl-2-like protein 1 refers to the rat version of this protein produced using recombinant DNA technology .

Function and Significance

Bcl2l1 plays a crucial role in maintaining the survival of various cell types, including hematopoietic cells and cancer cells . It prevents apoptosis by binding to and inhibiting pro-apoptotic proteins, thus ensuring the cell's survival under normal conditions and in response to certain stress signals .

Role in Cancer

In cancer, Bcl2l1 is often overexpressed, contributing to the survival and proliferation of cancer cells . Amplification of the BCL2L1 gene has been observed in various cancers, such as gastric cancer, where it promotes cell survival and drug resistance . Inhibiting Bcl2l1 can induce apoptosis in cancer cells, making it a target for cancer therapy .

Research Findings

  • Gene Amplification Effects: Research indicates that increased copy numbers of BCL2L1 in gastric cancer cells correlate with higher BCL2L1 protein expression . Downregulating BCL2L1 using siRNA reduces proliferation rates specifically in cells with BCL2L1 amplification .

  • Apoptosis and BH3 Mimetics: Knockdown of BCL2L1 increases apoptosis in cancer cells . The BH3 mimetic ABT-737, an inhibitor of BCL2L1, demonstrates a greater antiproliferative effect on BCL2L1-amplified cells .

  • Therapeutic Targeting: Compounds like compound 32 (BM-1074) have been developed as potent Bcl-2/Bcl-xL inhibitors, showing the potential for rapid and complete tumor regression in preclinical models .

  • Myelomonocytic Response Prediction: BCL2L1 is associated with resistance to the cytocidal effects of certain compounds, such as UNBS1450, in myelomonocytic cells .

  • MCL1 as Therapeutic Target: Methylation analysis has identified BCL2L1 methylation as linked to sensitivity to MCL1 inhibitors in pediatric cancers .

Data Tables

Table 1: Effects of BCL2L1 Amplification on Gastric Cancer Cells

FeatureBCL2L1 Amplified CellsBCL2L1 Non-Amplified Cells
Proliferation Rate ReductionYesNo
Increased ApoptosisYesNo
Sensitivity to ABT-737HigherLower

Table 2: Binding Affinities of Bcl-2/Bcl-xL Inhibitors

CompoundTargetKi (nM)
32Bcl-2<1
32Bcl-xL<1
1Mcl-11.5
1Bfl-11.6

Product Specs

Form
Supplied as a lyophilized powder.
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Bcl2l1; Bclx; Blc2l; Bcl-2-like protein 1; Bcl2-L-1; Apoptosis regulator Bcl-X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Uniprot No.

Target Background

Function

Bcl-2-like protein 1 (Bcl2l1) is a potent inhibitor of cell death, acting primarily by inhibiting caspase activation. It regulates cell death by binding to and blocking the voltage-dependent anion channel (VDAC), preventing the release of the caspase activator CYC1 from the mitochondrial membrane. Bcl2l1 also regulates the G2 checkpoint and cytokinesis during mitosis. The Bcl-xL isoform further regulates presynaptic plasticity, influencing neurotransmitter release and recovery, axonal mitochondrial number, and the size and number of synaptic vesicle clusters. During synaptic stimulation, it enhances mitochondrial ATP availability by modulating mitochondrial membrane ATP synthase F(1)F(0) activity and regulates endocytic vesicle retrieval in hippocampal neurons through interaction with DMN1L. In contrast, the Bcl-xS isoform promotes apoptosis.

Gene References Into Functions
  1. Impaired CK2 expression destabilizes Bcl-xL, impacting mitochondrial membrane potential via disruption of heat shock protein 90 chaperone function. PMID: 28597245
  2. Platelet-derived miR-142-3p, elevated in hypertension, modulates BCL2L1 expression, potentially influencing endothelial cell apoptosis. PMID: 28478796
  3. PGAM5 regulates cardiomyocyte apoptosis by controlling Keap1-mediated Bcl-xL degradation, suggesting a potential therapeutic target for acute myocardial infarction. PMID: 27815660
  4. Bcl-xL protein expression levels depend on neuronal activity, highlighting its role in neuroplasticity. PMID: 28320275
  5. Lithium's activation of hippocampal Bcl-xL expression suggests its involvement in treating stress-induced disorders. PMID: 28320276
  6. miR-665 contributes to propofol-induced neurotoxicity via caspase-3-mediated mechanisms by negatively regulating Bcl-2-like protein 1. PMID: 26254736
  7. Bcl-xL promotes neuronal outgrowth and protects neurites from hypoxia, contrasting with the role of DR6. PMID: 24787232
  8. The cyclin B1-Cdk1 complex in mitochondria phosphorylates Bcl-xL. PMID: 26109654
  9. The BH4 domain of Bcl-xL selectively targets VDAC1, inhibiting apoptosis by reducing VDAC1-mediated Ca(2+) mitochondrial uptake. PMID: 25681439
  10. Aminoguanidine treatment in diabetic animals reduces the Bax/Bcl-2 and Bax/Bcl-xL ratio. PMID: 24326522
  11. Down-regulation of miR-98 in the rat uterus during the receptive phase increases cell proliferation by targeting Bcl-xL. PMID: 24444606
  12. Dietary fiber upregulates Bcl-xL expression in distal colonic mucosa. PMID: 22424444
  13. Alternative splicing of bcl-x is a key regulator of apoptosis after acute neurological injury. PMID: 23015448
  14. Long-term fluoxetine treatment alters 5-HT and Bcl-xL responses to stress, correlating with antidepressant effects. PMID: 21740920
  15. ER retention of p75NTR downregulates Bcl-xL mRNA and inhibits NGF-induced neurite outgrowth. PMID: 22292018
  16. Bcl-xL is expressed in adult neurons and can be cleaved by caspases to produce a pro-death fragment, DeltaN-Bcl-x(L). PMID: 22366758
  17. Venlafaxine treatment reverses downregulated Bcl-xL levels in the hippocampus and myocardium in chronic mild stress. PMID: 21308783
  18. Increased mitochondrial energy metabolism efficiency via F1F0 ATPase synthase beta subunit contributes to enhanced synaptic efficacy in Bcl-x(L)-expressing neurons. PMID: 21926988
  19. BCL-X1 overexpression reduces hepatocyte apoptosis and protects mice from fulminant hepatic failure. PMID: 21863631
  20. GATA-3 mediates survival signals in osteoblasts, possibly by upregulating bcl-x(L) gene expression. PMID: 20499358
  21. Variations in the hippocampal Bcl-xL/Bax ratio may influence vulnerability to stress-induced depression. PMID: 20457187
  22. Grx1 knockdown in H9c2 cardiomyocytes decreases Bcl-xL production and increases apoptosis. PMID: 19938943
  23. Bcl-xL plays a role in dopamine neuron generation from neural stem cells. PMID: 20106970
  24. EGb 761 protects against ischemic brain injury by preventing the increase in Bad and Bcl-X(L) interaction. PMID: 19885947
  25. Spinal cord injury alters Bcl-xL expression, regulating the extent of apoptosis. PMID: 11721745
  26. Mitochondrial targeting of Bcl-x(L) requires the COOH-terminal transmembrane (TM) domain and flanking basic amino acids. PMID: 12515824
  27. Erythropoietin maintains genomic DNA integrity and cellular membrane asymmetry, preventing Apaf-1 induction and preserving mitochondrial membrane potential with enhanced Bcl-XL expression. PMID: 12621307
  28. The bcl-X gene responds to oxidative stress via distal promoter regions. PMID: 12721309
  29. Bcl-X(L) is crucial for hypoxia-induced death resistance. PMID: 14676192
  30. Bcl-XL overexpression in axotomized retinal ganglion cells enhances neurite regeneration. PMID: 15121179
  31. Akt1 promotes endothelial cell survival by preventing Bcl-x(L) degradation, inhibiting caspase activity. PMID: 15149850
  32. Bcl-xL mRNA is attenuated after traumatic injury. PMID: 15545017
  33. Rat Bcl-X(L) enhances dopaminergic differentiation of human neural stem cells. PMID: 15574729
  34. Bcl-xL expression prevents Murine Hepatitis Virus-induced cell death in oligodendrocytes. PMID: 15596800
  35. NF-kappaB may contribute to Bcl-x(L)-mediated protection against oxidative cell death. PMID: 15720830
  36. Bcl-xL may protect against delayed cell death by enhancing mitochondrial function. PMID: 16111822
  37. Ca2+ regulates Bcl-xS and Bcl-xL expression and cell fate. PMID: 16301318
  38. NF-kappaB inhibition blocks Bcl-XS upregulation and neuronal apoptosis. PMID: 16428456
  39. BAD membrane interaction is linked to 14-3-3 protein binding, Bcl-XL activation, and translocation. PMID: 16603546
  40. p21-mediated cytoprotection against hyperoxia involves Bcl-XL regulation. PMID: 16723699
  41. 1-Bromopropane inhibits NF-kappaB activation, reducing Bcl-xL expression in astrocytes. PMID: 16815550
  42. TMP increases Bcl-x(L) expression in rat proximal kidney tubules. PMID: 17132701
  43. Bcl-x(L) expression increases in pulmonary arteries during chronic vascular remodeling. PMID: 17272823
  44. dgRb1 upregulates Bcl-x(L) and VEGF expression. PMID: 17600519
  45. Bcl-x(L) inhibits caspase-dependent apoptosis but not caspase-independent neuronal death. PMID: 17644076
  46. A high soy diet enhances Bcl-x(L) expression, contributing to neuroprotection after ischemic stroke. PMID: 17706879
  47. Diabetes increases Bad and Bcl-X(L) interaction and reduces pBad and 14-3-3 binding. PMID: 17870134
  48. Bcl-xL overexpression increases resistance to apoptosis during ischemia. PMID: 18053090
  49. Bcl-xL expression shows segmental heterogeneity in rat tubular epithelium after ischemia-reperfusion. PMID: 18221257
  50. Bcl-xL regulates Drp1 to alter mitochondrial function and stimulate synapse formation. PMID: 18250306
Database Links
Protein Families
Bcl-2 family
Subcellular Location
[Isoform Bcl-X(L)]: Mitochondrion inner membrane. Mitochondrion outer membrane. Mitochondrion matrix. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cytoplasm, cytosol. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus membrane; Single-pass membrane protein; Cytoplasmic side.
Tissue Specificity
Expressed in most tissues. Bcl-X(beta) is specifically expressed in cerebellum, heart, and thymus. In the ovary, the predominant form is Bcl-X(L), with a small but detectable level of Bcl-X(S).

Q&A

What are the main isoforms of rat Bcl2l1 and how do they differ functionally?

Rat Bcl2l1 exists in multiple isoforms with distinct functional properties. The primary isoforms include a longer 284 amino acid form and a shorter 170 amino acid form, analogous to the human and mouse variants . The longer isoform functions as an apoptotic inhibitor (anti-apoptotic), while the shorter form acts as an apoptotic activator (pro-apoptotic) . This functional dichotomy is critical when designing experiments, as the isoform-specific effects can lead to dramatically different experimental outcomes.

The standard isoform used in most research applications is the 233 amino acid form, which corresponds to the anti-apoptotic Bcl-xL variant . When working with recombinant rat Bcl2l1, researchers should verify which specific isoform they are using, as this will determine the protein's functional activities in experimental systems.

What cellular mechanisms does rat Bcl2l1 regulate?

Rat Bcl2l1 plays a central role in regulating cellular apoptosis through several key mechanisms:

  • Mitochondrial membrane regulation: Bcl2l1 is located at the outer mitochondrial membrane where it regulates the voltage-dependent anion channel (VDAC) opening .

  • Control of mitochondrial membrane potential: Through its interaction with VDAC, Bcl2l1 modulates mitochondrial membrane potential, which directly affects cellular apoptotic signaling .

  • Regulation of reactive oxygen species (ROS): Bcl2l1 influences the production of ROS, which are potent inducers of cell apoptosis .

  • Cytochrome C release: By controlling mitochondrial membrane dynamics, Bcl2l1 regulates the release of cytochrome C, a critical step in the apoptotic cascade .

Researchers should consider these mechanisms when designing experiments to investigate Bcl2l1 function in different cellular contexts.

How is rat Bcl2l1 expression regulated in normal and pathological conditions?

Bcl2l1 expression varies across tissues and can be significantly altered in pathological states. While comprehensive expression data for rat Bcl2l1 is limited in the provided search results, studies indicate that Bcl2l1 expression can be regulated by:

  • Transcriptional control: Various transcription factors modulate Bcl2l1 expression in response to cellular stressors.

  • Alternative splicing: The production of different isoforms (anti-apoptotic vs. pro-apoptotic) is controlled by alternative splicing mechanisms .

  • Post-translational modifications: Phosphorylation and other modifications can alter Bcl2l1 stability and function.

In pathological contexts, Bcl2l1 has been implicated in therapy resistance mechanisms. For example, BCL2L1 contributes to platinum and PARP inhibitor resistance in ovarian cancer . Additionally, genome-wide CRISPR screening has revealed that loss of BCL2L1 creates a synthetic lethal interaction with radiation therapy, suggesting a role in radiation resistance .

What are the optimal methods for detecting rat Bcl2l1 in experimental samples?

Several validated methods exist for detecting rat Bcl2l1 in experimental samples:

Western Blotting:

  • Anti-BCL2L1 antibodies have been validated for Western blot analysis of rat samples .

  • When selecting antibodies, confirm that they specifically recognize your isoform of interest.

Immunohistochemistry (IHC):

  • IHC can be performed on both frozen and paraffin-embedded rat tissues .

  • For optimal results in frozen tissues, proper fixation protocols should be followed.

Flow Cytometry:

  • Anti-BCL2L1 antibodies have been validated for flow cytometric analysis of rat samples .

  • This method is particularly useful for analyzing Bcl2l1 expression in specific cell populations.

ELISA:

  • Sandwich ELISA kits for rat BCL2L1 provide quantitative measurement of protein levels .

  • These assays have a detection range of 46.88-3000 pg/mL with sensitivity of 11.72 pg/mL .

  • Validated sample types include serum, plasma, tissue homogenates, and cell lysates .

Detection MethodSample TypesDetection RangeSensitivity
ELISASerum, plasma, tissue homogenates, cell lysates46.88-3000 pg/mL11.72 pg/mL
Western BlotCell/tissue lysatesQualitativeVaries by antibody
Flow CytometryCellular suspensionsSemi-quantitativeVaries by antibody
IHCTissue sections (frozen/fixed)QualitativeVaries by antibody

How can I validate the functional activity of recombinant rat Bcl2l1 in my experimental system?

Validating the functional activity of recombinant rat Bcl2l1 is essential for experimental reliability. Consider these approaches:

  • Apoptosis assays: Since Bcl2l1 regulates apoptosis, functional validation should include assessment of its impact on programmed cell death.

    • For anti-apoptotic Bcl-xL: Test protection against induced apoptosis

    • For pro-apoptotic forms: Confirm promotion of apoptotic pathways

  • Binding partner analysis: Verify interactions with known binding partners:

    • Co-immunoprecipitation with other Bcl-2 family proteins

    • Assessment of interactions with VDAC or other mitochondrial components

  • Mitochondrial function assays:

    • Measure mitochondrial membrane potential using fluorescent dyes

    • Assess cytochrome C release in response to apoptotic stimuli

    • Quantify ROS production in the presence of recombinant Bcl2l1

  • Structure-function analysis:

    • Circular dichroism to confirm proper protein folding

    • Thermal shift assays to evaluate protein stability

For maximum confidence, researchers should combine multiple validation approaches tailored to their specific experimental questions.

What are the critical considerations when using Bcl2l1 inhibitors in research?

When using Bcl2l1 inhibitors in research, several critical factors should be considered:

  • Specificity profile: Many inhibitors target multiple Bcl-2 family members with varying affinities.

    • For example, ABT-737 targets both Bcl-2 and Bcl-xL .

    • A-1331852 is a more selective BCL-XL inhibitor .

  • Dosage optimization:

    • Establish dose-response relationships for your specific experimental system

    • The IC50 values of inhibitors can vary significantly between different cell types

  • Combination effects:

    • BCL2L1 inhibition combined with radiation therapy has shown synergistic effects in breast cancer models .

    • When designing combination experiments, carefully assess potential synergistic or antagonistic interactions.

  • Control experiments:

    • Include appropriate controls (vehicle, inactive analogs, etc.)

    • Confirm target engagement using techniques like cellular thermal shift assays

  • Cell type considerations:

    • Different cell types may express varying levels of Bcl2l1 and other Bcl-2 family members

    • This can significantly impact inhibitor efficacy and specificity

How can recombinant rat Bcl2l1 be used to study synthetic lethality in cancer models?

Recent research has revealed important synthetic lethal interactions involving Bcl2l1, offering promising avenues for cancer research:

  • Radiation therapy combination strategies:

    • Genome-wide CRISPR screening has identified that loss of BCL2L1 shows synthetic lethality with radiation therapy .

    • This interaction can be leveraged in experimental models by combining BCL2L1 inhibitors with radiation treatment.

    • In breast cancer models, this combination dramatically impeded tumor growth .

  • Experimental approach for synthetic lethality studies:

    • Use CRISPR/Cas9 to knock out Bcl2l1 in cancer cell lines

    • Compare sensitivity to various treatments between wildtype and Bcl2l1-knockout cells

    • Validate findings using pharmacological inhibitors of Bcl2l1

  • Considerations for in vivo studies:

    • Syngeneic models allow assessment of immune system contributions

    • Timing of inhibitor administration relative to radiation is critical

    • Monitoring both tumor growth and survival endpoints provides comprehensive assessment

  • Pathway analysis:

    • Complement synthetic lethality studies with transcriptomic and proteomic analyses

    • Identify compensatory mechanisms that may emerge following Bcl2l1 inhibition

    • Map the complete apoptotic signaling network to understand context-dependent effects

What are the emerging roles of Bcl2l1 in drug resistance mechanisms?

Bcl2l1 plays crucial roles in therapy resistance across multiple cancer types:

  • Chemotherapy resistance:

    • BCL2L1 has been implicated in platinum resistance in ovarian cancer .

    • This suggests potential benefit from combining platinum-based therapies with Bcl2l1 inhibitors.

  • PARP inhibitor resistance:

    • Evidence indicates that BCL2L1 contributes to resistance against PARP inhibitors in ovarian cancer .

    • This presents opportunities for combination therapy approaches.

  • Radiation resistance:

    • Loss of BCL2L1 sensitizes cells to radiation therapy .

    • This suggests that high BCL2L1 expression may contribute to radiotherapy resistance.

  • Experimental approaches to study resistance:

    • Generate resistant cell lines through prolonged exposure to therapeutic agents

    • Compare Bcl2l1 expression and function between parental and resistant lines

    • Use pharmacological inhibitors to determine if Bcl2l1 inhibition can restore sensitivity

    • Perform in vivo studies to validate in vitro findings

Understanding these resistance mechanisms can inform more effective therapeutic strategies and provide insights into the molecular determinants of treatment response.

How do different Bcl2l1 isoforms interact with other Bcl-2 family proteins?

The interactions between Bcl2l1 isoforms and other Bcl-2 family members are complex and context-dependent:

  • Heterodimerization patterns:

    • Bcl2l1 forms hetero- or homodimers with other Bcl-2 family proteins .

    • These interactions determine whether pro- or anti-apoptotic signals predominate.

    • The anti-apoptotic Bcl-xL isoform typically binds and neutralizes pro-apoptotic family members.

  • Structural basis of interactions:

    • Crystal structures (such as ABT-737 complexed with Bcl-xL) provide insights into the binding interface .

    • These structural data inform the design of selective inhibitors targeting specific interactions.

  • Experimental approaches to study interactions:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays for in situ detection of protein-protein interactions

    • FRET/BRET assays to monitor real-time interactions

    • Surface plasmon resonance to measure binding affinities

  • Tissue-specific interaction networks:

    • The composition of Bcl-2 family proteins varies across tissues

    • This creates tissue-specific interaction networks that influence apoptotic responses

    • Comprehensive profiling of multiple family members is recommended for accurate interpretation

Why might I observe inconsistent results when measuring Bcl2l1 expression across different experimental platforms?

Inconsistencies in Bcl2l1 detection can arise from several sources:

  • Isoform-specific detection:

    • Different antibodies and detection methods may preferentially recognize specific isoforms .

    • The longer (anti-apoptotic) and shorter (pro-apoptotic) isoforms can show distinct expression patterns.

    • Solution: Use isoform-specific antibodies or primers and include appropriate positive controls.

  • Technical considerations:

    • ELISA assays for rat BCL2L1 have high sensitivity (11.72 pg/mL) but can show intra-assay variation (CV% <8%) .

    • Western blotting may detect only abundant isoforms, missing low-expression variants.

    • Solution: Validate findings using multiple technical approaches.

  • Sample preparation impacts:

    • Different fixation methods can affect epitope accessibility in IHC applications .

    • Protein extraction protocols may yield variable recovery of membrane-bound proteins like Bcl2l1.

    • Solution: Standardize preparation methods and include internal controls.

  • Cross-reactivity issues:

    • Antibodies may cross-react with other Bcl-2 family members due to structural homology.

    • Solution: Verify antibody specificity using knockout/knockdown controls.

When encountering inconsistent results, systematic troubleshooting with appropriate controls is essential for reliable data interpretation.

How can I distinguish between the effects of different Bcl2l1 isoforms in my experiments?

Differentiating between the effects of different Bcl2l1 isoforms requires careful experimental design:

  • Isoform-specific genetic manipulation:

    • Use isoform-specific siRNA/shRNA targeting unique regions

    • Design CRISPR strategies that selectively modify specific isoforms

    • Employ isoform-selective overexpression constructs

  • Protein detection strategies:

    • Use antibodies that specifically recognize particular isoforms

    • Employ size-based separation methods (Western blotting) to distinguish isoforms by molecular weight

    • The standard anti-apoptotic isoform is 233 amino acids, while the pro-apoptotic isoform is 170 amino acids

  • Functional readouts:

    • Measure apoptotic markers (caspase activation, PARP cleavage)

    • Assess mitochondrial membrane potential

    • Monitor cytochrome C release

    • These readouts will show opposite effects depending on which isoform predominates

  • Computational approaches:

    • RNA-seq analysis can distinguish isoform-specific expression patterns

    • Develop isoform-specific gene signatures for more complex analyses

By combining these approaches, researchers can more confidently attribute observed effects to specific Bcl2l1 isoforms.

What controls should I include when studying Bcl2l1-mediated effects on apoptosis?

Robust experimental design for studying Bcl2l1-mediated apoptosis should include these controls:

Proper controls enable confident attribution of observed effects to Bcl2l1-mediated mechanisms rather than experimental artifacts or off-target effects.

How is Bcl2l1 being explored as a therapeutic target in combination therapies?

Recent advances highlight the potential of Bcl2l1 inhibition in combination therapeutic approaches:

  • Radiation therapy combinations:

    • BCL2L1 inhibition combined with radiation therapy dramatically impedes tumor growth in breast cancer models .

    • This synergistic effect was identified through unbiased whole-genome CRISPR/Cas9 screening .

    • The mechanism involves enhanced apoptotic response through synthetic lethality.

  • Chemotherapy combinations:

    • Given Bcl2l1's role in platinum resistance, combining Bcl2l1 inhibitors with platinum-based therapies may overcome resistance mechanisms .

  • Targeted therapy combinations:

    • PARP inhibitor resistance involving BCL2L1 suggests potential benefit from combining these agents with Bcl2l1 inhibitors .

  • Next-generation inhibitor development:

    • A-1331852 represents a newer generation of selective BCL-XL inhibitors with improved pharmacological properties .

    • APG-2575 is being explored for synthetic lethality with BTK or MDM2-p53 inhibitors in diffuse large B-cell lymphoma .

These emerging combination approaches highlight the expanding role of Bcl2l1 as a therapeutic target beyond single-agent applications.

What are the methodological considerations when studying Bcl2l1 across different experimental models?

When working with Bcl2l1 across diverse experimental models, researchers should consider:

  • Species-specific differences:

    • While human, mouse, and rat Bcl2l1 share significant homology, important structural and functional differences exist.

    • Rat Bcl2l1 (233 amino acids) has unique features that may affect inhibitor binding and protein-protein interactions .

    • Cross-species extrapolation of results requires validation.

  • Model system selection:

    • Cell line models: Ensure expression of relevant Bcl2l1 isoforms and binding partners

    • Animal models: Consider potential compensatory mechanisms in constitutive knockout models

    • Patient-derived models: Account for genetic background and treatment history

  • Translational considerations:

    • Correlate in vitro findings with in vivo observations

    • Validate mechanisms in multiple model systems

    • Consider pharmacodynamic/pharmacokinetic factors when translating to in vivo settings

  • Technical adaptations:

    • Detection methods may require optimization for different sample types

    • ELISA assays for rat BCL2L1 work across various sample types including serum, plasma, tissue homogenates, and cell lysates

    • Tissue-specific expression patterns necessitate appropriate normalization strategies

By addressing these methodological considerations, researchers can generate more robust and translatable insights into Bcl2l1 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.