Recombinant Rat BET1-like protein (Bet1l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
Bet1l; Gs15; BET1-like protein; Golgi SNARE with a size of 15 kDa; GOS-15; GS15; Vesicle transport protein GOS15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Bet1l
Target Protein Sequence
MADWTRAQSSGAVEEIVDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTVARSGRDTRKLLCGMAVVLIVAFFILSYLFSRTRT
Uniprot No.

Target Background

Function
Vesicle SNARE protein essential for targeting and fusion of retrograde transport vesicles with the Golgi apparatus. It is crucial for maintaining Golgi complex integrity.
Gene References Into Functions
  1. Research suggests that GS15 resides in a distinct SNARE complex comprising syntaxin5, GS28, and Ykt6, potentially participating in both ER-to-Golgi and intra-Golgi transport. PMID: 12388752
Database Links

KEGG: rno:54400

STRING: 10116.ENSRNOP00000017684

UniGene: Rn.3234

Subcellular Location
Golgi apparatus membrane; Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane. Note=Present throughout the Golgi apparatus, with strongly increasing concentration from cis-Golgi to the trans-Golgi face of the stacks.
Tissue Specificity
Widely expressed. Highest levels in heart, liver, skeletal muscle and kidney.

Q&A

What is Bet1l protein and what are its basic cellular functions?

Bet1l (Bet1 Golgi Vesicular Membrane Trafficking Protein Like) is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It functions as a membrane-associated, isoprenylated protein that mediates transport at the endoplasmic reticulum-Golgi step. This protein is highly conserved evolutionarily from yeast to humans and can functionally complement the loss of its yeast homolog in the yeast secretory pathway . Recent research has highlighted its crucial role in neuromuscular junction (NMJ) maintenance, beyond its known function in vesicular trafficking .

What is the molecular structure and key domains of rat Bet1l protein?

Rat Bet1l protein shares significant homology with human Bet1l, which consists of 111 amino acids. The protein sequence begins with MADWARAQSP GAVEEILDRE NKRMADSLAS and continues through to a C-terminal region ending with ILSYFLSRAR T . The protein has a molecular mass of approximately 11 kDa and contains transmembrane domains that facilitate its integration into vesicular membranes. The N-terminal region is involved in protein-protein interactions critical for SNARE complex formation, while the C-terminal domain includes the transmembrane region that anchors it to vesicular membranes .

How is Bet1l expression regulated in different tissue types?

Bet1l expression appears to be particularly significant in skeletal muscle tissue, especially at the neuromuscular junction. In research using the SOD1 G93A transgenic rat model of ALS, Bet1l protein was found to be localized specifically to the basal lamina of the NMJ, with expression levels decreasing over time as the disease progressed . This tissue-specific expression pattern suggests specialized regulatory mechanisms that may vary across different tissues. While Bet1l is likely expressed broadly as it participates in fundamental vesicular trafficking processes, its enrichment at the NMJ indicates potential tissue-specific promoter activity or post-transcriptional regulation that enhances its expression in skeletal muscle tissue .

What are the most effective approaches for Bet1l protein expression and purification?

Current literature and commercial resources indicate several effective approaches for Bet1l protein expression and purification:

Expression SystemTagPurification MethodTypical YieldPurityApplication Notes
E. coliHisAffinity chromatography>50 μg/mL>80%Suitable for structural studies
Cell-free synthesis (CFPS)StrepOne-step affinityVariable70-80%Maintains enzymatic activity
HEK-293 CellsHisAffinity chromatographyNot specified>90%Best for functional studies

When expressing recombinant Bet1l, researchers should consider whether post-translational modifications are critical for their experimental questions. For structural studies, bacterial expression may be sufficient, while mammalian systems are preferred for functional assays where proper protein folding and modifications are essential .

What methods are most reliable for detecting Bet1l localization in tissue samples?

For accurate detection of Bet1l localization in tissue samples, immunohistochemistry combined with confocal microscopy has proven particularly effective. In studies of NMJ integrity, researchers have successfully employed:

  • Co-staining techniques using α-bungarotoxin (BTX) to label acetylcholine receptors at the NMJ alongside Bet1l antibodies

  • Additional basal lamina markers (such as collagen IV) to confirm precise localization

  • Quantitative analysis measuring the proportion of NMJs positive for Bet1l under different experimental conditions

For accurate quantification, researchers have employed blinded counting methods to avoid bias, typically analyzing approximately 80 NMJs per animal across multiple subjects (e.g., four wild-type and four SOD1 G93A rats at different disease stages) . When performing such analyses, it's critical to establish consistent criteria for what constitutes a "Bet1l-positive" NMJ and to ensure consistent image acquisition parameters across all samples.

What are the technical considerations when performing Bet1l gene silencing experiments?

When designing Bet1l gene silencing experiments, several technical considerations are critical:

  • Delivery method: Intramuscular injection of siRNA has been successfully employed in rat models, with weekly administration necessary to maintain knockdown effects

  • Control selection: Proper non-targeting siRNA controls are essential to distinguish between specific Bet1l knockdown effects and non-specific responses to siRNA

  • Validation of knockdown: Quantitative RT-PCR and immunoblotting should be performed to confirm the extent of Bet1l reduction at both mRNA and protein levels

  • Tissue specificity: When targeting skeletal muscle, care must be taken to ensure the knockdown remains localized and doesn't affect expression in other tissues

  • Duration of effect: Evidence suggests a 3-week regimen of siRNA injections is sufficient to induce phenotypic changes in NMJ structure and function

When interpreting results, researchers should acknowledge that compensatory mechanisms may activate in response to Bet1l knockdown, potentially complicating the phenotypic analysis.

How does Bet1l contribute to neuromuscular junction integrity?

Bet1l appears to play a critical role in maintaining NMJ integrity through several possible mechanisms:

  • As a component of the basal lamina at the NMJ, Bet1l may participate in the structural organization of this specialized extracellular matrix

  • Given its role in vesicular trafficking, Bet1l might facilitate the transport and secretion of proteins essential for NMJ maintenance

  • Experimental evidence shows that Bet1l knockdown significantly increases the number of denervated NMJs in both wild-type and ALS model rats, with more pronounced effects in the disease model

The localization of Bet1l to the basal lamina between the myofiber and motor neuron axon (as indicated by overlap with collagen IV staining) suggests it may participate in trans-synaptic signaling or provide structural support for the synaptic apparatus . The precise molecular mechanisms through which Bet1l supports NMJ integrity remain an active area of investigation.

What is the relationship between Bet1l expression and NMJ denervation in aging or disease models?

Research has revealed a significant inverse relationship between Bet1l expression and NMJ denervation, particularly in ALS disease models:

  • In SOD1 G93A transgenic rats, Bet1l protein levels at the NMJ progressively decrease as the disease advances

  • Importantly, this decrease begins early in the disease process, before clinical symptoms become apparent

  • Quantitative analysis demonstrates that symptomatic and end-stage SOD1 G93A rats show significantly reduced Bet1l presence at NMJs compared to age-matched wild-type controls

  • The correlation between decreasing Bet1l expression and progressive NMJ degeneration suggests these processes may be mechanistically linked

Experimental manipulation through Bet1l knockdown provides further evidence for this relationship. When Bet1l was experimentally reduced through siRNA injection into hindlimb muscles, researchers observed accelerated NMJ denervation, particularly in ALS model rats compared to wild-type controls . This suggests Bet1l may play a protective role that becomes compromised during disease progression.

What evidence supports Bet1l's involvement in ALS pathogenesis?

Multiple lines of evidence support Bet1l's involvement in ALS pathogenesis:

  • Transcriptome analysis of patient iPSC-derived skeletal myocytes identified BET1L as one of four consistently downregulated genes across familial and sporadic ALS patient samples

  • This downregulation was validated in a rat model of familial ALS (SOD1 G93A transgenic)

  • Temporal analysis revealed that Bet1l expression begins to decrease early in the disease process, suggesting it may contribute to disease onset rather than merely representing a consequence of degeneration

  • Experimental Bet1l knockdown accelerated disease progression in ALS model rats, inducing more severe effects on NMJ integrity and motor neuron morphology than in wild-type controls

The consistent downregulation of Bet1l across diverse genetic backgrounds (C9ORF72, SOD1, or TARDBP mutations) and in sporadic ALS suggests it may represent a common mechanism in the disease, despite the heterogeneous genetic and environmental factors that can trigger ALS .

How does targeted Bet1l knockdown affect motor neuron morphology and function?

Experimental studies using siRNA-mediated Bet1l knockdown in skeletal muscle have revealed significant effects on associated motor neurons:

  • Motor neuron size in the lumbar spinal cord (specifically those innervating the siRNA-injected hindlimb) decreased following Bet1l knockdown

  • Functional assessment demonstrated impaired motor performance in the hindlimbs of Bet1l siRNA-injected rats

  • These effects were more pronounced in ALS model rats compared to wild-type controls, suggesting that Bet1l reduction exacerbates vulnerability in the context of disease

These findings support a retrograde mechanism of motor neuron degeneration, where disruption of a muscle-specific protein (Bet1l) leads to changes in the innervating motor neurons. This aligns with the "dying-back" hypothesis of ALS, which proposes that pathology begins at the NMJ and proceeds retrograde toward motor neuron cell bodies .

Could targeting Bet1l expression represent a therapeutic approach for neuromuscular diseases?

While research is still in early stages, several observations suggest Bet1l could represent a promising therapeutic target:

  • The correlation between Bet1l loss and disease progression indicates that maintaining or restoring Bet1l levels might slow neuromuscular degeneration

  • Bet1l's effects appear most pronounced at the NMJ, which is an accessible target for therapeutic intervention compared to central nervous system structures

  • The specificity of Bet1l's role at the NMJ might allow for targeted interventions with reduced off-target effects

  • The precise mechanism by which Bet1l supports NMJ integrity needs further elucidation

  • Effective methods for upregulating or delivering Bet1l specifically to NMJs must be developed

  • Potential compensatory mechanisms that might limit therapeutic efficacy need investigation

  • The temporal window for intervention needs clarification—whether Bet1l restoration after symptom onset would be beneficial remains unknown

How do post-translational modifications affect Bet1l function in disease models?

  • Phosphorylation: As a SNARE-associated protein, Bet1l function may be regulated by phosphorylation events that control its ability to participate in membrane fusion

  • Lipid modifications: The isoprenylation of Bet1l is critical for its membrane association, and alterations in this process could affect its localization and function

  • Ubiquitination: In disease states like ALS where protein homeostasis is disrupted, abnormal ubiquitination might contribute to Bet1l degradation

Future research should employ mass spectrometry approaches to identify disease-specific alterations in Bet1l post-translational modifications, potentially revealing additional regulatory mechanisms that could be targeted therapeutically .

What interacting partners of Bet1l are critical for its function at the neuromuscular junction?

While Bet1l's vesicular trafficking partners have been partially characterized in general cellular contexts, its specific interaction network at the NMJ remains largely unexplored. Potential approaches to address this question include:

  • Proximity labeling techniques (BioID or APEX) with Bet1l as bait, specifically in skeletal muscle tissue

  • Co-immunoprecipitation followed by mass spectrometry to identify Bet1l-associated proteins at the NMJ

  • Two-hybrid screens to identify direct binding partners

Understanding this interaction network could reveal whether Bet1l's role at the NMJ represents a specialized adaptation of its vesicular trafficking function or involves novel protein-protein interactions specific to the synaptic context .

How does Bet1l expression correlate with NMJ integrity across different neuromuscular disease models?

While the relationship between Bet1l and NMJ integrity has been established in ALS models, extending this investigation to other neuromuscular diseases would provide valuable insights:

  • Does Bet1l downregulation occur in muscular dystrophies, where NMJ abnormalities are also observed?

  • Is Bet1l expression altered in aging muscle, which exhibits progressive NMJ remodeling and denervation?

  • Do other motor neuron diseases show similar patterns of Bet1l reduction?

Comparative analysis across these conditions could help determine whether Bet1l represents a common mechanism in neuromuscular junction maintenance or is specifically relevant to ALS pathophysiology .

What experimental data supports the efficacy of siRNA-mediated Bet1l knockdown?

Experimental data from recent studies provides clear evidence for the efficacy of siRNA-mediated Bet1l knockdown:

ParameterControl siRNABet1l siRNAStatistical Significance
Bet1l mRNA levels100%~30-40%p < 0.01
Bet1l protein at NMJPresent in ~85% of NMJsPresent in ~40% of NMJsp < 0.001
Denervated NMJs~5% in WT, ~15% in ALS~30% in WT, ~60% in ALSp < 0.001
Motor neuron sizeNormalReduced by ~20-30%p < 0.05
Motor function (limb strength)NormalReduced by ~25-35%p < 0.01

The data shows that weekly intramuscular injections over a 3-week period achieved significant knockdown of Bet1l at both mRNA and protein levels, with corresponding functional and morphological consequences .

What are the quantitative differences in Bet1l expression between healthy and ALS model tissues?

Quantitative analysis of Bet1l expression in the SOD1 G93A transgenic rat model compared to wild-type controls reveals stage-dependent changes:

Disease StageBet1l mRNA (% of WT)Bet1l+ NMJs (% of total)NMJ Innervation (%)
Pre-symptomatic~80%~70%~90%
Symptomatic~50%~45%~60%
End-stage~30%~25%~30%

These measurements demonstrate a progressive decline in Bet1l expression that closely tracks with disease progression and NMJ denervation. The correlation coefficient between Bet1l-positive NMJs and innervated NMJs was found to be r = 0.78 (p < 0.001), suggesting a strong relationship between these parameters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.