Recombinant Rat Bifunctional apoptosis regulator (Bfar)

Shipped with Ice Packs
In Stock

Description

Mechanisms of Apoptosis Regulation

Bfar modulates apoptosis through dual pathways:

Intrinsic pathway inhibition

  • Binds Bcl-2/Bcl-X<sub>L</sub> via its SAM domain, sequestering Bax and preventing mitochondrial cytochrome c release .

  • Reduces ER stress-induced apoptosis by attenuating IRE1 signaling .

Extrinsic pathway inhibition

  • Binds Caspase-8 via its DED-like domain, blocking Fas-mediated activation .

  • Suppresses Caspase-3 activity (e.g., DEVD-AFC cleavage reduced by 60% in BAR-overexpressing cells) .

Experimental Findings in Rat Models

Key studies using recombinant Bfar variants:

Table 1: Neuroprotective Effects of Bfar Overexpression

Cell TypeApoptotic StimulusProtection by Bfar (% Reduction in Apoptosis)Source
CSM neuronal cellsStaurosporine (0.01 μM)35%
CSM neuronal cellsTNF-α (50 ng/ml)62%
CSM neuronal cellsThapsigargin (0.3 μM)50%
Transgenic mouse heartsIschemia/reperfusion injury40% reduction in infarct size

Table 2: Cardiac Protection by BARΔRING

ModelOutcomeEffect of BARΔRING OverexpressionSource
Ischemia/reperfusionCaspase-3 activation55% reduction
Doxorubicin toxicityLeft ventricular ejection fractionPreserved function (58% vs. 42% control)

Therapeutic Implications

  • Neuroprotection: Bfar’s high neuronal expression and ER localization make it a candidate for treating neurodegenerative diseases .

  • Cardioprotection: BARΔRING reduces cardiomyocyte apoptosis by 50% in ischemia/reperfusion models .

  • Metabolic regulation: Bfar interacts with sulfur metabolism pathways, influencing cysteine availability and apoptosis in hepatocytes .

Research Gaps and Future Directions

  • No studies directly report the production of full-length recombinant rat Bfar using systems like baculovirus (contrast with BDNF/NT-3 methods in ).

  • The role of Bfar in stress-resilient vs. stress-vulnerable rat strains (e.g., Roman High-/Low-Avoidance rats) remains unexplored, despite known BDNF/trkB differences .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly indicate it in your order notes. We will fulfill your request if possible.
Lead Time
The delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Bfar; Bifunctional apoptosis regulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Bfar
Target Protein Sequence
MEEPQKNDLSMRGQEEDHPVRSSGPQISVSEFSCHCCYDTLVNPTTLNCGHSFCRHCLAL WWMSSKKTECPECREKWEGFPKVNILLRDAIEKLFPDAIKMRVEDIQQNNDVVQSLAAFQ KYGNDQNPLAPSTGRVNQQRGGGFFSGVLTALTGVAVILLVYHWRSRESEHGLLVHKAVD KWTTEEVVLWLEQLGPWASLYRDRFLSERVNGRLLLTLTEEEFSRAPYTIENSSHRRVIL MELERVRALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLGLLYLYLFDYTDSFLPFIH TICPLQEDSFGEDIFTKLLDLREPTWKQWREFLIKYSFLPYQLIAEFAWDWLEVHYWTSR FLIVNAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFMAMFWPLIPQFVCN CLFYWALYFNPIINIDLVVKEIRRLETQVF
Uniprot No.

Target Background

Function
Bifunctional apoptosis regulator (Bfar) is an apoptosis regulator that exhibits anti-apoptotic activity. It protects cells from apoptosis triggered by both death receptors and mitochondrial factors.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of rat Bifunctional apoptosis regulator (Bfar)?

Rat Bifunctional apoptosis regulator (Bfar) is a 450 amino acid protein containing four distinct domains: (i) an N-terminal zinc-binding RING domain (amino acids 24-86); (ii) a SAM domain (amino acids 180-254); (iii) a coiled-coil domain (amino acids 273-345); and (iv) a C-terminal transmembrane (TM) domain (amino acids 400-428). The TM domain anchors the protein to the endoplasmic reticulum membrane. Computational models and experimental data suggest Bfar contains multiple transmembrane helices that create a complex topology, with the RING domain positioned on the opposite side of the membrane from the SAM domain .

How does Bfar's domain organization relate to its bifunctional nature?

The bifunctional character of Bfar derives from its ability to simultaneously regulate both extrinsic and intrinsic apoptosis pathways through distinct structural domains. The coiled-coil domain, which shares limited sequence homology with death effector domains (DEDs), associates with procaspases-8 or -10, thereby blocking Fas-induced activation of the extrinsic apoptosis pathway. Concurrently, the SAM domain facilitates interaction with Bcl-2 and Bcl-X, influential regulators of the intrinsic (mitochondrial) apoptotic pathway. This dual functionality allows Bfar to serve as a critical integration point for diverse apoptotic signals .

How does Bfar function as an E3 ubiquitin ligase?

Bfar functions as a polytopic E3 ubiquitin ligase primarily through its N-terminal RING domain, which transfers ubiquitin from an E2 conjugating enzyme to target substrate proteins. Studies have identified UBE2D2 as a preferred E2 ubiquitin-conjugating enzyme for Bfar. In reconstituted in vitro ubiquitylation reactions, Bfar demonstrates auto-ubiquitylation capability in the absence of substrate. Interestingly, the addition of substrate proteins like PNPLA3 reduces Bfar auto-ubiquitylation, suggesting a substrate-dependent regulation mechanism. Structurally, the RING domain coordinates zinc ions and adopts a canonical fold that facilitates recruitment of charged E2~Ub conjugates for subsequent transfer to target proteins .

What are the known protein substrates of Bfar E3 ligase activity?

Research has identified several proteins as substrates for Bfar-mediated ubiquitylation:

  • PNPLA3 (Patatin-like phospholipase domain-containing protein 3): Bfar promotes ubiquitylation and subsequent degradation of PNPLA3, a key protein involved in lipid metabolism. Genetic inactivation of Bfar in mice resulted in a twofold increase in PNPLA3 protein levels without corresponding increases in mRNA levels, confirming Bfar's role in post-translational regulation .

  • BI-1 (Bax inhibitor 1): Bfar has been shown to promote the degradation of this ER-associated protein in cultured cells .

  • ATGL (Adipose triglyceride lipase): Some evidence suggests Bfar may also target ATGL, though the effect appears more modest than with PNPLA3 .

Methodologically, substrate identification typically employs approaches such as proteomic analysis following Bfar manipulation, co-immunoprecipitation studies, and in vitro reconstitution assays with purified components.

How does BARΔRING modification affect protein function and stability?

BARΔRING refers to a modified version of Bfar lacking the N-terminal RING domain. This modification has several significant consequences:

  • Increased protein stability: The RING domain facilitates auto-ubiquitylation and proteasome-dependent destruction of Bfar. Removal of this domain prevents this self-regulation mechanism, resulting in protein accumulation .

  • Preserved anti-apoptotic function: Despite lacking the E3 ligase activity conferred by the RING domain, BARΔRING retains the ability to interact with both extrinsic and intrinsic apoptotic machinery through its SAM and coiled-coil domains .

  • Enhanced protective effects: Transgenic mice overexpressing BARΔRING in the heart demonstrate increased resistance to ischemia/reperfusion injury and doxorubicin-induced cardiotoxicity, with significantly reduced cardiomyocyte apoptosis .

This strategic modification illustrates how domain-specific alterations can be leveraged to enhance specific protein functions while eliminating others, providing valuable insights for therapeutic applications.

What are the optimal expression systems for producing functional recombinant rat Bfar?

The optimal expression system depends on experimental goals and which aspects of Bfar functionality are being studied. For different applications, researchers should consider:

For full-length Bfar:

  • Mammalian cell systems (HEK293, CHO cells) provide appropriate post-translational modifications and membrane insertion machinery necessary for producing properly folded transmembrane proteins.

  • Insect cell systems (Sf9, High Five) offer a compromise between mammalian systems' folding capacity and higher protein yield.

For soluble domains (e.g., RING domain alone):

  • Bacterial expression in E. coli can provide high yields of correctly folded individual domains, particularly the RING or SAM domains.

For structural studies:

  • Consider using constructs lacking the transmembrane domain or employing fusion partners that enhance solubility.

Regardless of the expression system selected, incorporating appropriate affinity tags (His, GST, FLAG) facilitates subsequent purification steps while minimizing interference with protein function .

How can researchers validate the apoptosis-regulatory effects of recombinant Bfar in experimental systems?

Validation of Bfar's apoptosis-regulatory functions requires multi-parameter assessment:

Assay TypeMethodologyWhat It MeasuresControls
Annexin V/PI stainingFlow cytometryEarly/late apoptotic cell populationsBARΔRING expression, Bfar knockdown
Caspase activity assaysFluorogenic substrate cleavageActivation of specific caspases (8, 9, 3/7)Specific caspase inhibitors
Mitochondrial membrane potentialJC-1 or TMRE dyesIntegrity of mitochondrial membraneCCCP as positive control
Cytochrome c releaseSubcellular fractionation + Western blotIntrinsic pathway activationBcl-2 overexpression
TUNEL assayMicroscopy/Flow cytometryDNA fragmentationDNase treatment

For in vivo validation, researchers have successfully employed transgenic mice overexpressing BARΔRING, demonstrating reduced cardiac injury following ischemia/reperfusion and doxorubicin treatment compared to wild-type controls. These protective effects correlate with decreased TUNEL-positive nuclei, indicating reduced apoptosis .

What methods are effective for studying Bfar's interaction with both extrinsic and intrinsic apoptotic machinery?

Several complementary approaches can effectively characterize Bfar's interactions with apoptotic machinery:

  • Co-immunoprecipitation (Co-IP): For capturing native protein complexes from cell lysates. This has been successfully used to demonstrate interactions between Bfar and apoptotic proteins like procaspases and Bcl-2 family members.

  • Proximity ligation assay (PLA): For visualizing and quantifying protein interactions within intact cells with spatial resolution, particularly valuable for membrane-associated proteins like Bfar.

  • GST pull-down assays: Using recombinant domains of Bfar (e.g., SAM or coiled-coil) to identify direct binding partners from cell lysates or with purified candidates.

  • FRET/BRET approaches: For detecting real-time interactions in living cells, particularly useful for monitoring dynamic changes in Bfar interactions following apoptotic stimuli.

  • Split-protein complementation: Systems like split-luciferase can report on specific protein-protein interactions in cellular contexts.

When designing these experiments, it's critical to include appropriate negative controls (e.g., BARΔRING for E3 ligase activity studies) and to validate findings using multiple complementary approaches .

How does Bfar modification impact cardiovascular disease models?

Genetic modification of Bfar, specifically through BARΔRING overexpression, demonstrates significant cardioprotective effects in experimental models:

  • Ischemia/Reperfusion (I/R) Injury: Transgenic mice overexpressing BARΔRING exhibited substantially reduced myocardial infarct size following I/R injury compared to wild-type mice. Specifically, these animals showed a 42% reduction in infarct area when subjected to 30 minutes of ischemia followed by 24 hours of reperfusion .

  • Doxorubicin-Induced Cardiotoxicity: BARΔRING overexpression significantly attenuated cardiac dysfunction and cardiomyocyte apoptosis resulting from doxorubicin treatment, a chemotherapeutic agent known for dose-limiting cardiotoxicity .

  • Mechanism of Protection: In both models, cardioprotection correlated with reduced cardiomyocyte apoptosis, as evidenced by decreased TUNEL-positive nuclei and reduced caspase activation. This suggests that Bfar's anti-apoptotic functions, rather than its E3 ligase activity, are primarily responsible for these protective effects .

These findings highlight the potential therapeutic value of targeting Bfar pathways in cardiovascular diseases characterized by excessive cardiomyocyte apoptosis.

What is Bfar's role in fatty liver disease pathogenesis?

Bfar plays a significant role in fatty liver disease through its regulation of PNPLA3 (patatin-like phospholipase domain-containing protein 3):

  • PNPLA3 Regulation: Bfar functions as an E3 ubiquitin ligase that promotes ubiquitylation and subsequent degradation of PNPLA3, a key protein associated with lipid metabolism in the liver .

  • Genetic Evidence: The PNPLA3(I148M) variant is the most impactful genetic risk factor for fatty liver disease. This variant is poorly ubiquitylated and accumulates on lipid droplets. Interestingly, siRNA-mediated knockdown of Bfar increases PNPLA3 levels in hepatocytes, while Bfar overexpression decreases PNPLA3 levels .

  • In Vivo Confirmation: Genetic inactivation of Bfar in mice (Bfar^-/-) resulted in a twofold increase in PNPLA3 protein levels in hepatic lipid droplets without corresponding increases in mRNA levels, confirming Bfar's role in post-translational regulation of PNPLA3 .

These findings suggest that enhancing Bfar activity could potentially accelerate PNPLA3 turnover, particularly the disease-associated I148M variant, providing a novel therapeutic approach for fatty liver disease.

How might targeting Bfar be developed as a therapeutic strategy?

Developing Bfar-targeted therapeutics presents several promising strategies:

  • For Cardiovascular Protection:

    • Gene therapy approaches delivering BARΔRING to protect cardiomyocytes from ischemia- or chemotherapy-induced apoptosis

    • Small molecules that mimic BARΔRING's anti-apoptotic effects without affecting E3 ligase activity

  • For Fatty Liver Disease:

    • Small molecule enhancers of Bfar E3 ligase activity to increase degradation of disease-associated PNPLA3 variants

    • Peptide-based approaches targeting the Bfar-PNPLA3 interaction interface to enhance substrate recognition

  • Delivery Challenges:

    • As a membrane-associated protein, targeting Bfar presents delivery challenges

    • Nanomedicine approaches or AAV-based gene delivery systems could provide targeted delivery to specific tissues

  • Potential Off-Target Effects:

    • Given Bfar's multiple substrates and dual role in apoptosis regulation, therapeutic strategies must carefully consider potential off-target effects

    • Tissue-specific targeting would be crucial to minimize systemic effects

Research is needed to fully elucidate tissue-specific functions of Bfar and develop therapeutic approaches that selectively modulate desired activities while minimizing unintended consequences .

How do post-translational modifications regulate Bfar function?

While the search results don't specifically address post-translational modifications (PTMs) of Bfar beyond ubiquitylation, several theoretical possibilities warrant investigation:

  • Auto-ubiquitylation: The RING domain facilitates Bfar's auto-ubiquitylation and subsequent proteasomal degradation. This self-regulatory mechanism likely influences protein turnover rates and steady-state levels .

  • Phosphorylation: As an ER-associated protein involved in stress responses, Bfar may be regulated by kinases activated during ER stress or apoptotic signaling. Potential phosphorylation sites could modulate domain interactions, substrate recognition, or subcellular localization.

  • S-palmitoylation: Given its multiple transmembrane domains, Bfar might undergo palmitoylation to regulate membrane association or protein-protein interactions within membrane microdomains.

  • Glycosylation: As an ER protein, Bfar may contain N-linked glycosylation sites that influence protein folding, stability, or function.

Advanced methodologies like mass spectrometry-based proteomics following enrichment for specific PTMs could identify modification sites and dynamic changes in response to cellular stress or apoptotic stimuli.

What are the methodological challenges in studying membrane topology of Bfar?

Investigating the membrane topology of Bfar presents several technical challenges:

  • Multiple Transmembrane Helices: Computational models predict Bfar contains at least four transmembrane helices (TMH1-4), creating a complex topology . This complexity makes traditional topology mapping approaches challenging.

  • Protein Extraction Issues: As a polytopic membrane protein, Bfar requires detergents for extraction, which can potentially disrupt native conformation and interactions.

  • Expression Challenges: Heterologous expression of full-length Bfar may result in misfolding or aggregation, particularly when overexpressed.

  • Inconsistent Computational Predictions: Different prediction algorithms may yield conflicting topological models, necessitating experimental validation.

Advanced methodologies to address these challenges include:

  • Cysteine scanning mutagenesis combined with accessibility assays

  • Glycosylation mapping approaches

  • Cryo-electron microscopy of purified protein in membrane mimetics

  • Split GFP complementation for domain localization

  • Hydrogen-deuterium exchange mass spectrometry

The AlphaFold structural model provides a starting point, but experimental validation remains essential for accurate topology determination .

How might differential splicing or isoform expression of Bfar influence tissue-specific functions?

While the search results don't specifically mention alternative splicing or isoforms of Bfar, this represents an important area for investigation:

  • Potential Tissue-Specific Isoforms: Different tissues might express Bfar variants with altered domain compositions, potentially explaining tissue-specific phenotypes observed in studies.

  • Functional Consequences: Alternative splicing could generate variants lacking specific domains (similar to the engineered BARΔRING), resulting in proteins with distinct functional properties:

    • Variants lacking the RING domain would lose E3 ligase activity but retain anti-apoptotic functions

    • Variants with altered transmembrane domains might localize to different cellular compartments

    • Isoforms with modified substrate-binding regions might target different proteins for degradation

  • Experimental Approaches:

    • RNA-seq analysis across tissues to identify tissue-specific transcript variants

    • Isoform-specific antibodies for protein detection

    • CRISPR-based isoform tagging for localization and interaction studies

    • Isoform-specific knockout models to assess functional differences

Understanding the isoform diversity of Bfar could provide insights into tissue-specific functions and offer more precise therapeutic targeting strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.