Recombinant Rat Bile acyl-CoA synthetase (Slc27a5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its inclusion.
Synonyms
Slc27a5; Acsb; Fatp5; Vlacsr; Bile acyl-CoA synthetase; BACS; Bile acid-CoA ligase; BA-CoA ligase; BAL; Cholate--CoA ligase; Fatty acid transport protein 5; FATP-5; Solute carrier family 27 member 5; Very long-chain acyl-CoA synthetase-related protein; VLACS-related; VLACSR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-690
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGVWKKLTFLLLSLLLLVGLGQPLWPAATALALRWFLGDPTCFVLLGLAFLGRPWISSWI PHWLSLAAAALTLSLLPPRPPPELRWLHKDVAFAFKLLFYGLNLRRRLNRHPPELFVDAL EQQAQARPDQVALVCTGSEGCSITNRELNAKACQAAWALKAKLKEATIQEDKGATAILVL PSKSISALSVFLGLAKLGCPVAWINPHSRGMPLLHSVQSSGASVLIVDPDLQENLEEVLP KLLAENIRCFYLGHSSPTPGVEALGAALDAAPSDPVPAKLRANIKWKSPAIFIYTSGTTG LPKPAILSHERVIQMSNVLSFCGRTADDVVYNVLPLYHSMGLVLGVLGCLQLGATCVLAP KFSASRYWAECRQYSVTVVLYVGEVLRYLCNVPGQPEDKKHTVRFALGNGLRADVWENFQ QRFGPIQIWELYGSTEGNVGLMNYVGHCGAVGKTSCFIRMLTPLELVQFDIETAEPVRDK QGFCIPVETGKPGLLLTKIRKNQPFLGYRGSQDETKRKLVANVRQVGDLYYNTGDVLALD QEGFFYFRDRLGDTFRWKGENVSTREVEGVLSILDFLEEVNVYGVTVPGCEGKVGMAAVK LAPGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSQLAREGFDVGVIAD PLYILDNKAETFRSLMPDVYQAVCEGTWKL
Uniprot No.

Target Background

Function

Bile acyl-CoA synthetase (also known as SLC27A5) is a recombinant rat enzyme that catalyzes the activation of bile acids through the formation of bile acid CoA thioesters. This process is essential for subsequent conjugation with glycine or taurine. It primarily activates chenodeoxycholic acid, a primary bile acid, but also efficiently catalyzes the activation of other primary (cholic acid) and secondary (deoxycholic acid and lithocholic acid) bile acids. The enzyme also displays acyl-CoA synthetase activity, activating very long-chain fatty acids (VLCFAs) by forming fatty acyl-CoA. In vitro studies indicate activity with 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid in de novo cholesterol synthesis. Furthermore, SLC27A5 exhibits long-chain fatty acid (LCFA) transport activity, playing a crucial role in hepatic fatty acid uptake, bile acid reconjugation, and recycling; however, it is not involved in de novo bile acid synthesis.

Database Links
Protein Families
ATP-dependent AMP-binding enzyme family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in liver (at protein level).

Q&A

What is the fundamental function of Rat Bile acyl-CoA synthetase (Slc27a5)?

Rat Bile acyl-CoA synthetase (Slc27a5) is a specialized acyl-CoA synthetase involved in bile acid metabolism that catalyzes the first step in the conjugation pathway of bile acids. It specifically activates C24 bile acids (choloneates) to their CoA thioesters, which is essential before their conjugation with glycine and taurine and subsequent excretion into bile canaliculi. This enzyme primarily activates secondary bile acids returning to the liver via enterohepatic circulation. Additionally, it can activate 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid derived from cholesterol through de novo synthesis .

What is the molecular structure and genetic characteristics of Rat Bile acyl-CoA synthetase?

Rat Bile acyl-CoA synthetase (rBAL) is encoded by a cDNA (rBAL-1) with a 51 nucleotide 5'-untranslated region, an open reading frame of 2,070 bases encoding a 690 amino acid protein with a molecular mass of 75,960 Da, and a 138 nucleotide 3'-nontranslated region followed by a poly(A) tail. Sequence analysis places it firmly within the fatty acid CoA synthetase/FATP gene family. The protein shares highest homology with a mouse VLACS-related protein (87.2% identity, 93.3% similarity) and exhibits 65.2-65.5% similarity and 42.3-43.9% identity to VLACS proteins from rat, mouse, and human sources .

How does Slc27a5 relate to other acyl-CoA synthetases in evolutionary and functional terms?

Phylogenetic analysis demonstrates that Slc27a5 (rBAL) is a member of the fatty acid CoA synthetase/fatty acid transport protein (FATP) gene family. The protein displays significant homology with very long-chain acyl-CoA synthetases (VLACS) across species, with 65.2-65.5% similarity and 42.3-43.9% identity to VLACS proteins from rat, mouse, and human. This evolutionary relationship suggests a shared ancestral origin and potentially overlapping functions. The inhibition of Slc27a5 by cis-unsaturated fatty acids provides compelling evidence for a biochemical relationship between fatty acid and bile acid metabolism pathways. Unlike some related acyl-CoA synthetases (ACS1 and ACS4), Slc27a5 may have distinct inhibition patterns and substrate preferences, reflecting its specialized role in bile acid metabolism .

What expression systems are optimal for producing functional recombinant Rat Bile acyl-CoA synthetase?

For producing functional recombinant Rat Bile acyl-CoA synthetase, insect Sf9 cells have proven to be an effective expression system. The enzyme expressed in Sf9 cells demonstrates catalytic properties comparable to the enzyme isolated from rat liver. When designing expression constructs, researchers should consider that the rBAL-1 cDNA contains a 51 nucleotide 5'-untranslated region and a 138 nucleotide 3'-nontranslated region, which may influence expression efficiency. Alternative expression systems such as E. coli have been successfully used for related acyl-CoA synthetases, particularly when employing affinity tags like the Flag epitope at the C-terminus, which has been shown not to alter kinetic properties. For mammalian expression, baculovirus systems have demonstrated good results with related enzymes. Researchers should carefully validate the enzymatic activity of the expressed protein using appropriate assays to ensure proper folding and functionality .

What methods are most effective for measuring and characterizing Slc27a5 enzymatic activity?

For measuring Slc27a5 enzymatic activity, a combination of biochemical assays and analytical techniques provides the most comprehensive characterization. The standard approach involves incubating the purified enzyme with bile acid substrates (such as CDCA, CA, DCA, or LCA), ATP, and CoA under optimized conditions. The formation of bile acid-CoA esters can be detected and quantified using HPLC and MALDI-TOF mass spectrometry, which allows for precise identification of reaction products. When determining kinetic parameters, researchers should consider testing a range of substrate concentrations to accurately calculate Km values, which have been reported between 18-64 μM for CDCA depending on the enzyme preparation. Comparisons between different enzyme sources (native versus recombinant) and preparations (with or without affinity tags) are essential for comprehensive characterization. Additionally, activity assays should include controls for potential inhibitors and account for the enzyme's specific requirements for detergents like Triton X-100, which might influence activity measurements .

What factors affect the stability and activity of purified Slc27a5 in experimental settings?

Several factors significantly impact the stability and activity of purified Slc27a5 in experimental settings. Temperature sensitivity is a critical consideration, as related acyl-CoA synthetases demonstrate varying degrees of thermolability. The pH optimum must be carefully maintained, as small deviations can substantially affect enzymatic activity. The presence of detergents, particularly Triton X-100, may be essential for maintaining protein solubility and activity, similar to requirements observed for other acyl-CoA synthetases. Thiol-modifying reagents such as N-ethylmaleimide and arginine-modifying reagents like phenylglyoxal can affect activity, suggesting the importance of these residues in catalytic function. Storage conditions including buffer composition, temperature, and the presence of stabilizing agents can significantly impact long-term stability. When designing experiments, researchers should conduct preliminary stability studies to determine optimal conditions for their specific experimental setup and include appropriate controls to account for potential activity loss during storage or assay procedures .

How can genetic manipulation techniques be applied to study Slc27a5 function in vivo?

Genetic manipulation techniques offer powerful approaches to study Slc27a5 function in vivo. CRISPR-Cas9 genome editing can be employed to generate knockout or knockin rat models to investigate the physiological consequences of Slc27a5 deficiency or to introduce specific mutations to study structure-function relationships. AAV-mediated gene delivery systems can be used for liver-specific overexpression or knockdown of Slc27a5 in adult animals, avoiding potential developmental compensations. For temporally controlled manipulation, inducible expression systems such as tetracycline-responsive elements can be valuable. RNA interference through shRNA or siRNA approaches provides a complementary strategy for transient knockdown in cellular models or in vivo using hydrodynamic injection. When designing these genetic studies, researchers should consider potential compensatory mechanisms by related acyl-CoA synthetases, which might mask phenotypes in complete knockout models. Partial knockdown or the use of dominant-negative mutants might provide more nuanced insights into Slc27a5 function in complex physiological contexts .

What methodologies can reveal the interconnection between Slc27a5 and lipid metabolism disorders?

To investigate the interconnection between Slc27a5 and lipid metabolism disorders, researchers should employ a multi-faceted methodological approach. Metabolic profiling using liquid chromatography-mass spectrometry (LC-MS) can characterize changes in bile acid profiles, conjugation patterns, and related lipid metabolites in Slc27a5-manipulated models. Stable isotope labeling combined with metabolic flux analysis can track the fate of bile acids and fatty acids, revealing how Slc27a5 alterations affect metabolic pathways. Transcriptomic and proteomic analyses of liver tissue from models with altered Slc27a5 expression can identify compensatory mechanisms and downstream effectors. Functional assays measuring bile acid transport, fatty acid uptake, and lipid accumulation in hepatocytes with modified Slc27a5 levels can establish direct mechanistic links. Clinical correlation studies examining Slc27a5 expression or genetic variants in patients with conditions like non-alcoholic fatty liver disease, cholestasis, or dyslipidemia can provide translational relevance. This comprehensive approach would elucidate the specific role of Slc27a5 in the complex interplay between bile acid metabolism and lipid homeostasis .

How can structural biology approaches contribute to understanding Slc27a5 catalytic mechanisms?

Structural biology approaches would significantly advance our understanding of Slc27a5 catalytic mechanisms. X-ray crystallography or cryo-electron microscopy of purified Slc27a5, ideally in complex with substrates, products, or inhibitors, would reveal the three-dimensional architecture of the enzyme and identify key catalytic residues and binding pockets. Molecular dynamics simulations based on structural data could elucidate conformational changes during catalysis and substrate recognition. Hydrogen-deuterium exchange mass spectrometry could map protein dynamics and ligand-induced conformational changes. Site-directed mutagenesis guided by structural insights, followed by enzymatic characterization, would validate the functional roles of specific residues. Comparing the structure of Slc27a5 with related acyl-CoA synthetases would highlight structural features that confer specificity for bile acids versus fatty acids. These structural insights could guide the design of specific inhibitors or activators with potential therapeutic applications. When pursuing structural studies, researchers should consider the membrane-associated nature of the enzyme, which might require specialized approaches such as the use of detergents, nanodiscs, or lipid cubic phase crystallization methods .

How should researchers reconcile variability in kinetic parameters reported for Slc27a5 across different studies?

Reconciling variability in kinetic parameters reported for Slc27a5 requires careful consideration of multiple experimental factors. First, enzyme source variability significantly impacts measurements, as demonstrated by the different Km values reported for CDCA: 18 μM for purified rat liver BAL, 32 μM for native rBAL in Sf9 microsomes, and 64 μM for His-tagged rBAL. Researchers should directly compare different enzyme preparations within the same experimental setup to quantify these differences. Assay condition variations, including pH, temperature, ionic strength, and detergent concentration, can substantially alter measured kinetic parameters. The presence and position of affinity tags can modify enzyme behavior, necessitating controls with untagged protein when possible. Different analytical methods for measuring product formation may have varying sensitivities and sources of error. When comparing data across studies, researchers should normalize results using internal standards and benchmark substrates. Meta-analysis approaches that account for these experimental variables can help establish consensus values for kinetic parameters. Ultimately, researchers should report all experimental conditions in detail and acknowledge these sources of variability when interpreting kinetic data .

ParameterValueReference
Km for CDCA (purified rat liver BAL)18 μM
Km for CDCA (native rBAL in Sf9 microsomes)32 μM
Km for CDCA (His-tagged rBAL)64 μM
Physiological bile acid concentration range20-100 μM

What approaches can resolve contradictory findings regarding Slc27a5 substrate specificity?

Resolving contradictory findings regarding Slc27a5 substrate specificity requires a systematic, multi-faceted approach. Comprehensive substrate screening using consistent experimental conditions across all potential substrates provides a foundation for comparative analysis. Detailed enzyme kinetics with multiple substrates, measuring both Km and Vmax values, offers quantitative assessment of substrate preferences. Competition assays, where multiple substrates compete for the enzyme, can reveal relative affinities under physiologically relevant conditions. Structural studies examining substrate binding, potentially using substrate analogs or catalytically inactive mutants, can identify molecular determinants of specificity. Validation studies in cellular or in vivo models, tracking the metabolism of different substrates in systems with normal or altered Slc27a5 expression, connect in vitro findings to physiological relevance. When interpreting contradictory findings, researchers should consider that specificity may be concentration-dependent and influenced by cellular context, including the presence of other enzymes and metabolic conditions. The historical progression of research methods and analytical techniques should also be considered when evaluating older versus newer findings .

Bile Acid SubstrateActivityReference
Chenodeoxycholic acid (CDCA)Active substrate
Cholic acid (CA)Active substrate
Deoxycholic acid (DCA)Active substrate
Lithocholic acid (LCA)Active substrate
Trihydroxycoprostanoic acid (THCA)Active substrate
cis-Unsaturated fatty acidsInhibitors

How should tissue-specific expression patterns of Slc27a5 be interpreted in the context of its biological function?

Interpreting tissue-specific expression patterns of Slc27a5 requires careful consideration of both methodological and biological factors. While Slc27a5 is primarily expressed in liver, consistent with its role in bile acid metabolism, apparent detection in other tissues requires rigorous validation. Researchers should employ multiple detection methods including qPCR, Western blotting, and immunohistochemistry, with appropriate positive controls (liver tissue) and negative controls (knockout tissues when available). Antibody specificity must be verified, as cross-reactivity with related FATP family members can lead to false positives. Low-level expression in non-hepatic tissues may indicate tissue-specific functions unrelated to classical bile acid metabolism, potentially involving fatty acid activation or metabolism of other carboxylic acids. Developmental, nutritional, and pathological states can significantly alter expression patterns, necessitating careful experimental design that accounts for these variables. When expression is detected in unexpected tissues, functional studies measuring enzymatic activity are essential for confirming biological relevance. Inter-species differences should also be considered, as expression patterns may not be conserved across mammals despite high sequence homology .

What novel technological approaches could advance understanding of Slc27a5 regulation in physiological and pathological conditions?

Novel technological approaches for studying Slc27a5 regulation could significantly advance our understanding of this enzyme in both health and disease. Single-cell transcriptomics and proteomics would reveal cell-type specific expression patterns within the liver, potentially identifying specialized hepatocyte subpopulations with distinct Slc27a5 expression levels. Spatial transcriptomics could map Slc27a5 expression across liver zones, correlating with metabolic gradients. CRISPR interference or activation (CRISPRi/CRISPRa) systems targeting the Slc27a5 promoter or enhancers would enable precise manipulation of endogenous gene expression. Chromatin immunoprecipitation sequencing (ChIP-seq) and ATAC-seq could identify transcription factors and regulatory elements controlling Slc27a5 expression under different physiological states. Proximity labeling methods (BioID or APEX) could map the Slc27a5 protein interaction network in intact cells. Optogenetic or chemogenetic approaches to acutely activate or inhibit Slc27a5 would reveal immediate versus adaptive responses to altered enzyme activity. Patient-derived organoids or humanized mouse models would enhance translational relevance when studying disease conditions. These advanced technologies, applied in integrated research programs, would provide unprecedented insights into the complex regulation of Slc27a5 in physiological and pathological contexts .

What are the potential implications of Slc27a5 in non-canonical pathways beyond bile acid metabolism?

The potential involvement of Slc27a5 in non-canonical pathways beyond classic bile acid metabolism represents an exciting frontier for future research. The significant homology between Slc27a5 and fatty acid transport proteins suggests potential roles in fatty acid uptake or metabolism in specialized contexts. The enzyme's ability to activate various carboxylic acids to CoA derivatives might extend to xenobiotics, therapeutic agents, or signaling molecules beyond bile acids. The inhibition of Slc27a5 by cis-unsaturated fatty acids points to potential regulatory crosstalk between fatty acid and bile acid metabolism that could be important in metabolic adaptation. The enzyme might participate in the metabolism of specialized lipid mediators with signaling functions. Investigation of these non-canonical pathways would require metabolomic approaches using untargeted analysis to identify novel Slc27a5 substrates, chemical proteomics to capture enzyme-substrate interactions, and functional studies in cellular and animal models with manipulated Slc27a5 expression. Understanding these alternative functions could reveal unexpected roles for Slc27a5 in cellular physiology and pathology beyond the liver and traditional bile acid metabolism .

How might understanding Slc27a5 structure-function relationships lead to novel therapeutic strategies?

Elucidating Slc27a5 structure-function relationships could open several avenues for therapeutic innovation. Structure-based drug design targeting specific domains or catalytic residues could yield selective modulators of Slc27a5 activity with potential applications in cholestatic diseases, metabolic disorders, or conditions with altered bile acid signaling. Identification of natural variations in the Slc27a5 gene associated with altered bile acid profiles or disease susceptibility could guide personalized therapeutic approaches. Engineering modified versions of Slc27a5 with enhanced activity or altered substrate specificity could lead to enzyme replacement therapies for specific bile acid metabolism disorders. Development of allosteric modulators that modify enzyme activity in response to metabolic states could provide dynamic therapeutic tools. Gene therapy approaches delivering optimized Slc27a5 variants to the liver could address genetic deficiencies. Beyond direct targeting, understanding structural determinants of substrate specificity could guide the design of bile acid analogs or conjugates with improved pharmacokinetic properties. These therapeutic strategies would require extensive preclinical validation in cellular and animal models, with careful attention to potential compensatory mechanisms and off-target effects on related acyl-CoA synthetases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.