Recombinant Rat Blood vessel epicardial substance (Bves)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Bves; Pop1; Popdc1; Blood vessel epicardial substance; Popeye domain-containing protein 1; Popeye protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Bves
Target Protein Sequence
MNFTEPSPLAQSTVVGFLPELESLTPVPSNETSCENWREVHHLVFHAANVCFAVGLLIPT TLHLHMILLRVMLSIGCTLYVVWATLYRCALDMMIWNSVFLGINILHLSYLLYKKRPVKI EKDLGGVYHRLFEPLRVPPDLFRRLTGQFCVIQTLKRGQVYATEDKTSVDDRLSILLKGR MKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLE SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLSTQISMLEMRNSITSSS DIEDGLHHFLRGSSSTASLPMSSPQQRASPKMKPIEEGLEDDDEVFVPVSPAHQLP
Uniprot No.

Target Background

Function
Blood vessel epicardial substance (Bves) is a cell adhesion molecule crucial for maintaining cell integrity and regulating tight junction (TJ) permeability in epithelial cells. It plays a role in VAMP3-mediated vesicular transport and receptor recycling through its interaction with VAMP3. Furthermore, Bves modulates cell shape and movement by influencing Rho-family GTPase activity via interaction with ARHGEF25/GEFT. It also promotes epithelial cell adhesion and aggregation independently of calcium. Bves is essential for skeletal muscle and heart development, contributing to striated muscle regeneration, cell spreading, and cardiac function maintenance. It regulates heart rate dynamics, potentially by increasing the cell surface expression of the potassium channel KCNK2 and enhancing current density. Finally, as a caveolae-associated protein, it maintains caveolae structure and function and protects the heart from ischemia injury.
Gene References Into Functions
  1. Popdc1, a component of Bves, is a caveolae-associated protein vital for preserving caveolae structure, function, and cardiac protection against ischemia. PMID: 24066022
  2. Cell surface Bves/Pop1A, comprising an extracellular amino terminus, three transmembrane domains, and a cytoplasmic carboxyl terminus, regulates its cellular distribution during coronary vessel development. PMID: 12815060
Database Links

KEGG: rno:365603

UniGene: Rn.41396

Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.
Tissue Specificity
Strongly expressed in heart and skeletal muscle. Weakly expressed in brain, spleen, liver, kidney and lung.

Q&A

What are the standard formulations for reconstituting recombinant rat Bves protein?

Similar to other recombinant proteins like Noggin, recombinant rat Bves should be reconstituted following specific protocols to maintain biological activity. For lyophilized formulations, reconstitution at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin is typically recommended . Carrier-free versions may be reconstituted directly in sterile PBS without additional proteins. After reconstitution, the solution should be stored according to manufacturer guidelines to prevent degradation through repeated freeze-thaw cycles .

How should recombinant rat Bves be stored to maintain stability?

Proper storage is crucial for maintaining protein activity. Based on protocols for similar recombinant proteins, lyophilized Bves should be stored at -20°C to -80°C upon receipt. After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles, which can significantly reduce biological activity. Use a manual defrost freezer rather than self-defrosting options to prevent temperature fluctuations that could compromise protein integrity . When stored properly, recombinant proteins typically maintain activity for at least 6-12 months.

What expression systems are commonly used for producing recombinant rat Bves?

While specific information about Bves expression systems isn't provided in the search results, the standard approach for recombinant rat proteins involves gene optimization, vector construction, and expression in bacterial systems. For example, the methodology used for recombinant B. bovis AMA-1 involved selecting the target sequence, optimizing codons, synthesizing the DNA, and inserting it into an expression vector (such as pQE-32) with appropriate restriction enzyme sites . The recombinant plasmid can then be transformed into E. coli strains like M15 using heat shock methods, followed by selection on media containing appropriate antibiotics .

What are the optimal conditions for inducing recombinant rat Bves expression in bacterial systems?

Based on established protocols for recombinant protein expression, optimal induction of rat Bves in bacterial systems would likely involve the following methodology:

  • Grow transformed bacteria in appropriate media containing selection antibiotics (e.g., 100 μg/ml ampicillin and 25 μg/ml kanamycin) to an OD600 of approximately 0.6

  • Induce protein expression using IPTG at a final concentration of 0.5 mM

  • Continue incubation for 12-16 hours at 37°C with shaking at 250 rpm

  • Harvest cells by centrifugation at 4,000 × g for 20 minutes at 4°C

  • Store cell pellets at -20°C until purification

This approach maximizes protein yield while maintaining the biological activity of the recombinant protein.

What purification strategies are most effective for recombinant rat Bves?

Although specific purification methods for Bves aren't detailed in the search results, histidine-tagged recombinant proteins are typically purified using immobilized metal affinity chromatography (IMAC). If Bves is expressed with a His-tag (similar to other recombinant proteins), researchers should consider:

  • Lysing bacterial cells using appropriate buffers containing protease inhibitors

  • Clarifying the lysate by centrifugation and filtration

  • Performing IMAC purification using nickel or cobalt resins

  • Washing with increasing concentrations of imidazole to reduce non-specific binding

  • Eluting the purified protein with high imidazole concentrations

  • Dialyzing against PBS or other appropriate buffers to remove imidazole

This methodical approach results in high-purity recombinant protein suitable for downstream applications.

What assays are recommended for verifying the biological activity of recombinant rat Bves?

Biological activity verification is crucial for recombinant proteins. While specific Bves activity assays aren't detailed in the search results, approaches similar to those used for other recombinant rat proteins would be appropriate. For example, interleukin-5 activity is verified through:

  • Cell proliferation assays using responsive cell lines in a concentration-dependent manner

  • Inhibition studies with neutralizing antibodies to confirm specificity

  • Colony formation assays with primary cells (e.g., bone marrow cells) to assess differentiation effects

  • Cell viability and survival assays to measure time- and concentration-dependent effects

For Bves, researchers should develop activity assays based on its known biological functions, potentially including cell adhesion, epithelial integrity, or other relevant activities.

How can researchers validate antibody specificity against recombinant rat Bves?

Antibody validation is essential for reliable research results. Based on standard protocols, researchers should:

  • Perform Western blotting with purified recombinant Bves alongside negative controls

  • Conduct immunofluorescence antibody tests (IFAT) using cells expressing Bves versus non-expressing controls

  • Implement competitive binding assays with increasing concentrations of purified recombinant Bves

  • Test antibody cross-reactivity with related proteins or Bves from other species

  • Verify signal elimination when antibodies are pre-incubated with purified recombinant Bves

These validation steps ensure experimental results accurately reflect Bves biology rather than non-specific interactions.

What strategies exist for developing vaccine formulations using recombinant rat Bves?

While the search results don't specifically address Bves vaccines, the methodology used for other recombinant proteins provides valuable insights. Based on the approach used with B. bovis AMA-1, researchers might:

  • Purify recombinant Bves to high homogeneity (>95%)

  • Test different protein concentrations (e.g., 50 μg and 100 μg per dose)

  • Formulate with appropriate adjuvants, such as Montanide ISA 206 VG in a 1:1 volume ratio

  • Prepare control formulations containing only adjuvant in PBS

  • Store formulations at 4°C until use

This methodological approach allows for systematic evaluation of immune responses to recombinant Bves in appropriate animal models.

How can researchers utilize cross-species databases to inform rat Bves studies?

The Rat Genome Database (RGD) offers powerful tools for cross-species research. Researchers studying rat Bves can:

  • Search for orthologous genes across species using the Gene-Ortholog Location Finder (GOLF) tool

  • Access species-centric portals directly from the RGD homepage for consolidated species-specific data

  • Utilize OntoMate with search presets for rat-specific literature

  • Analyze disease and pathway annotations that may involve Bves

  • Employ RGD analysis tools such as the Object List Generator and Analyzer (OLGA) and Gene Annotator (GA)

This integrated approach allows researchers to leverage data from multiple species, enhancing the understanding of Bves function through comparative genomics.

What are common challenges in expressing soluble recombinant rat Bves and how can they be addressed?

While specific challenges for Bves aren't detailed in the search results, recombinant proteins often face similar obstacles. Researchers should consider:

  • Codon optimization for E. coli expression systems, as demonstrated with other recombinant proteins

  • Testing multiple bacterial strains (beyond standard M15) that may enhance soluble expression

  • Optimizing induction conditions by testing various IPTG concentrations, temperatures, and induction times

  • Using fusion tags that enhance solubility (e.g., MBP, GST, or SUMO) in addition to purification tags

  • Employing specialized growth media and buffer systems to improve protein folding

Methodical optimization of these parameters can significantly improve the yield and quality of recombinant Bves protein.

How should researchers troubleshoot loss of biological activity in recombinant rat Bves preparations?

Activity loss is a common challenge with recombinant proteins. Based on established practices:

  • Minimize freeze-thaw cycles by storing the protein in single-use aliquots

  • Add carrier proteins (such as BSA) to dilute preparations to enhance stability

  • Optimize buffer conditions (pH, salt concentration, additives) to maintain native conformation

  • Consider the addition of protease inhibitors during purification and storage

  • Perform activity assays immediately after reconstitution when possible

  • Test alternative formulations, including lyophilization with stabilizing excipients

These approaches help maintain the structural integrity and functional activity of recombinant proteins during storage and experimental use.

How does rat Bves compare functionally with orthologous proteins in other species?

Cross-species comparison is valuable for understanding conserved functions. Researchers studying rat Bves should:

  • Use RGD to identify orthologous genes across species through the GOLF tool

  • Compare sequence conservation across critical functional domains

  • Analyze expression patterns in equivalent tissues across species

  • Examine phenotypic data from knockout or mutant models in multiple species

  • Consider species-specific differences that may impact experimental design

The RGD provides an infrastructure for these comparisons, facilitating the transfer of knowledge across species barriers and potentially identifying conserved functions of Bves .

What bioinformatic tools are most valuable for analyzing rat Bves sequence and structure?

Based on resources mentioned in the search results, researchers should utilize:

  • The Rat Genome Database (RGD) for gene information, annotations, and ortholog identification

  • Species-specific JBrowse genome browsers for genomic context analysis

  • InterViewer for visualizing protein-protein interactions that may involve Bves

  • Pathway Portal diagrams to understand Bves in broader biological pathways

  • Variant Visualizer to investigate rat genetic variants related to Bves

These bioinformatic approaches provide a comprehensive understanding of Bves from sequence to function, enhancing experimental design and interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.