Recombinant Rat Bombesin receptor subtype-3 (Brs3)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

Rat Bombesin receptor subtype-3 (Brs3) belongs to the G-protein coupled receptor (GPCR) superfamily and shares between 47-51% homology with other known bombesin receptors . The rat Brs3 gene has been isolated, cloned, and fully sequenced, revealing its characteristic GPCR structure with seven transmembrane domains . The encoded protein consists of 399 amino acids, placing it in the class A GPCR family .

The genomic organization of rat Brs3 includes several introns and exons, with important restriction endonuclease sites identified within the gene structure . The gene is located on chromosome Xq37 in rats, which corresponds to similar X-chromosome locations in humans (Xq26.3) and mice (X A6) .

Sequence Homology and Species Differences

Despite having a high degree of sequence similarity with the human BRS-3 (80% identical), rat Brs3 exhibits markedly different pharmacological properties . This divergence in functionality despite sequence conservation represents an intriguing aspect of this receptor and highlights the significance of specific amino acid residues in determining receptor-ligand interactions.

The table below summarizes the key gene and protein information across species:

SpeciesAmino AcidsChromosomal LocationGene SymbolUniProtKB Identifier
Rat399Xq37Brs3Q8K418
Mouse399X A6Brs3O54798
Human399Xq26.3BRS3P32247

Central Nervous System Distribution

Contrary to earlier reports suggesting limited expression in the rat brain, comprehensive studies using reverse transcription followed by quantitative polymerase chain reaction and immunohistological techniques have demonstrated that Brs3 is widely expressed throughout the rat central nervous system (CNS) . Particularly strong expression has been observed in key brain regions including the cerebral cortex, hippocampal formation, hypothalamus, and thalamus . Additional areas showing Brs3 immunopositivity include the basal ganglia, midbrain, and reticular formation .

This extensive distribution pattern suggests that Brs3 may play significant roles in various CNS functions, potentially mediating the actions of an as-yet-unidentified endogenous ligand . The wide expression of Brs3 in the rat brain is comparable to the distribution pattern of other bombesin-like peptide receptors, indicating potentially parallel or complementary functions .

Specific Nuclei with Functional Significance

Within the hypothalamus, Brs3 shows notable expression in the paraventricular hypothalamic nucleus (PVH), dorsomedial hypothalamic nucleus (DMH), and medial preoptic area (MPA) . These areas are known to be involved in the regulation of energy homeostasis, suggesting a potential role for Brs3 in controlling feeding behavior and energy expenditure . Significantly, the Brs3 neurons in the PVH demonstrated strong c-Fos induction after refeeding, indicating their activation during satiety .

Cloning and Expression Systems

The recombinant production of rat Brs3 involves isolating the nucleic acid molecule encoding the receptor and introducing it into suitable expression systems . The process begins with RT-PCR to identify and isolate the rat Brs3 cDNA, which is then inserted into expression vectors for subsequent transfection into host cells .

The recombinant DNA technology allows for the production of the receptor in various cellular systems, facilitating detailed studies of its structure and function . Common expression systems include mammalian cell lines such as 293EBNA cells, which have been successfully used to express HA-epitope tagged rat Brs3 for comparative studies with the human receptor .

Expression Vector Construction

The construction of expression vectors for rat Brs3 typically involves ligating the cDNA into suitable vectors containing appropriate promoters for either constitutive or inducible expression . The choice of promoter can influence not only the level of expression but also potentially allow for tissue-targeted expression in more complex systems .

In research settings, successful expression of recombinant rat Brs3 has been verified using various techniques, including ELISA assays that measure the presence of epitope-tagged receptors on the cell surface . This approach allows for quantitative assessment of receptor expression levels, which is crucial for subsequent functional studies.

Ligand Binding Characteristics

While the natural ligand for Brs3 remains unknown, synthetic peptides have been developed that interact with this receptor . Notably, the synthetic peptide dY-Q-W-A-V-(β-A)-H-F-Nle-amide (abbreviated as dYB or dY-bombesin) shows significant species differences in its binding affinity and potency .

The rat Brs3 exhibits remarkably lower affinity for dY-bombesin compared to human BRS-3, with an EC50 value of approximately 2 μM for rat Brs3 versus 1.2 nM for human BRS-3 . This represents an approximately 1,667-fold difference in potency, highlighting the substantial pharmacological divergence between species despite high sequence similarity .

Molecular Basis for Species Differences

Detailed investigations into the molecular basis for the pharmacological differences between rat and human Brs3 have identified specific extracellular domains that are critical for ligand recognition and binding . Chimeric receptor studies, where individual extracellular loops of rat Brs3 were replaced with corresponding human sequences, revealed that the third extracellular loop (E3) plays a crucial role in determining ligand binding properties .

A chimeric receptor (designated RB3-E3) containing the human E3 loop in the rat Brs3 backbone displayed pharmacological properties nearly identical to those of human BRS-3, binding dY-bombesin with high affinity (Ki = 1.2 ± 0.7 nM) and responding to it with high potency (EC50 = 1.8 ± 0.5 nM) . Further mutation studies identified that multiple residues within this loop contribute to the species-specific differences in ligand recognition .

Primary Signal Transduction Pathways

Rat Brs3, like other members of the bombesin receptor family, primarily couples to the Gq/G11 family of G-proteins, leading to the activation of phospholipase C and subsequent increase in intracellular calcium levels . Additionally, the receptor stimulates phospholipase D and activates protein kinase C, contributing to its diverse cellular effects .

The signaling cascade initiated by Brs3 activation includes the phosphorylation of p125 focal adhesion kinase, representing an important mechanism through which this receptor may influence cellular functions .

Secondary Signaling Mechanisms

Beyond its primary signaling pathways, Brs3 activation triggers several secondary transduction mechanisms involving tyrosine kinase cascades . These include the activation of mitogen-activated protein kinase (MAPK), epidermal growth factor receptor (EGFR) transactivation, and stimulation of transcription factors such as CREB, MEK, and ELK-1 .

The receptor's activation also leads to phosphorylation of paxillin and involves reactive oxygen species, matrix metalloproteinases, and Src in its signaling network . These complex signaling mechanisms likely underlie the diverse physiological functions attributed to Brs3.

Role in Energy Homeostasis

One of the most significant physiological roles proposed for Brs3 is its involvement in energy homeostasis . Studies investigating the Brs3-mediated neuronal pathways have demonstrated that specific Brs3-expressing neurons in the hypothalamus respond to feeding status and may regulate food intake and energy expenditure .

The activation of Brs3 neurons, particularly in the paraventricular hypothalamic nucleus (PVH), following refeeding suggests their role in satiety signaling . Additionally, administration of Brs3 agonists alters the expression of feeding-regulating peptides in the brain, including proopiomelanocortin (Pomc) and cocaine- and amphetamine-regulated transcript (Cart), further supporting Brs3's role in energy balance regulation .

Other Potential Functions

Given its widespread expression in the rat brain, Brs3 likely contributes to multiple neurological functions beyond energy homeostasis . The strong expression in cognitive centers such as the cerebral cortex and hippocampal formation suggests potential roles in learning, memory, and other higher cognitive functions .

The presence of Brs3 in areas associated with autonomic regulation, such as the hypothalamus, indicates possible involvement in controlling various autonomic functions, although specific roles remain to be fully elucidated .

Receptor Characterization Studies

Recombinant rat Brs3 has been instrumental in comparative pharmacological studies, particularly those investigating species differences in receptor properties . By creating chimeric receptors and specific point mutants, researchers have identified critical domains and amino acid residues that determine the receptor's pharmacological profile .

These studies have not only enhanced our understanding of the structure-function relationships within the bombesin receptor family but have also provided valuable insights into the molecular determinants of ligand recognition and receptor activation .

Physiological Function Investigations

Recombinant rat Brs3 has facilitated investigations into the receptor's physiological roles, particularly in energy homeostasis . By allowing for the development of specific agonists and enabling the identification of Brs3-expressing neurons, recombinant receptor technologies have contributed significantly to our understanding of Brs3-mediated pathways in feeding regulation .

Additionally, the availability of recombinant rat Brs3 has supported studies examining the receptor's signaling mechanisms, helping to elucidate the complex cascades through which Brs3 exerts its cellular effects .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate your preferences when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Brs3; Bombesin receptor subtype-3; BRS-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSQRQPQSPNQTLISITNDTETSSSAVSNDTTPKGWTGDNSPGIEALCAIYITYAVIISV GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGC KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCAKAGGIWIMAMIFAL PEAIFSNVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVFYIIPLSIISVYYSLI ARTLYKSTLNIPTEEQSHARKQIESRKRIAKTVLVLVALFALCWLPNHLLYLYHSFTYES YAEPSDVPFVVTIFSRVLAFSNSCVNPFALYWLSKTFQKHFKAQLCCFKAEQPEPPLGDT PLNNLTVMGRVPATGSAHVSEISVTLFSGSTAKKGEDKV
Uniprot No.

Target Background

Function
Plays a role in sperm cell division, maturation, or function. This receptor mediates its action through association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. This study demonstrated comprehensive mapping of BRS-3 mRNA in the rat brain. Double in situ hybridization was performed to determine whether BRS-3 colocalizes with other neurotransmitters or neuropeptides. PMID: 22911445
  2. The results indicate that the sequence variation in the E3 loop is responsible for the species difference between rat and human BRS-3. Multiple residues in the E3 loop are involved in interactions with the agonist dY-bombesin. PMID: 12102638
  3. Bombesin receptor subtype-3 (BRS-3) was detected in the rat adult and fetal kidney. PMID: 15140764
  4. Brs3 is expressed by the enteric nervous system and by interstitial cells of Cajal in the gastrointestinal tract. PMID: 15726424
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bombesin Receptor Subtype-3 and how is it classified?

Bombesin receptor subtype-3 (Brs3) is an X-linked G protein-coupled receptor that belongs to the mammalian bombesin receptor family. It was initially termed BRS-3 when discovered in 1993 due to its 47-51% amino acid identity with other bombesin receptors . Brs3 is classified as the third subtype (BB3) in the bombesin receptor family, alongside BB1 (NMB-R, neuromedin B preferring receptor) and BB2 (GRP-R, gastrin-releasing peptide preferring receptor) . Despite its structural similarity to other bombesin receptors, Brs3 has distinct pharmacological properties and is considered an orphan receptor because no high-affinity endogenous ligand has been definitively identified .

What is the molecular structure and genetic location of rat Brs3?

Rat Brs3 shares approximately 80% sequence identity with human BRS-3, despite significant pharmacological differences between the species . The human BRS-3 gene is located on chromosome Xq25 and encodes a protein of 399 amino acids . The rat Brs3 gene follows a similar structure but contains key sequence variations, particularly in the third extracellular loop (E3), which accounts for the pharmacological differences between rat and human variants . These structural differences are critical considerations when designing experiments with recombinant rat Brs3 or when translating findings between species.

How do rat and human Brs3 differ pharmacologically, and what are the molecular bases for these differences?

Despite the high sequence similarity (80% identical) between rat and human Brs3, they exhibit marked pharmacological differences . A synthetic peptide, dY-Q-W-A-V-(beta-A)-H-F-Nle-amide (dY-bombesin), activates human BRS-3 with high potency (EC₅₀ of 1.2 nM) but shows poor potency for rat Brs3 (EC₅₀ = 2 μM) .

Research using chimeric receptors has identified that the third extracellular loop (E3) is responsible for these species differences. When the E3 loop of rat Brs3 was replaced with the corresponding human sequence, the resulting chimeric receptor (RB3-E3) behaved almost identically to human BRS-3, binding dY-bombesin with high affinity (Kᵢ = 1.2 ± 0.7 nM) and being activated with high potency (EC₅₀ = 1.8 ± 0.5 nM) . Further mutation studies within the E3 loop identified specific residue changes that partially account for these species differences:

  • Mutation of Y₂₉₈E₂₉₉S₃₀₀ to S₂₉₈Q₂₉₉T₃₀₀ (RB3-SQT)

  • Mutation of D₃₀₆V₃₀₇P₃₀₈ to A₃₀₆M₃₀₇H₃₀₈ (RB3-AMH)

These findings highlight the importance of considering species-specific pharmacology when designing experiments with recombinant rat Brs3 .

What approaches have been used to identify potential endogenous ligands for Brs3?

The search for an endogenous Brs3 ligand has employed several innovative approaches. One significant method involved parabiosis, the surgical union of two animals to enable circulatory exchange . This technique was used to detect potential circulating endogenous Brs3 ligands, based on the hypothesis that ablation of a receptor often increases the level of its cognate ligand .

Researchers created parabiotic pairs between Brs3 null (Brs3⁻/ʸ) and wild-type (WT) mice or between WT controls. After 9 weeks on a high-fat diet, the Brs3⁻/ʸ-WT pairs weighed more than the WT-WT pairs, with Brs3⁻/ʸ mice showing greater adiposity than their WT partners . These results contrast with findings from parabiotic pairs of leptin receptor null (Lepr⁻/ʸ) and WT mice, where high leptin levels in the Lepr⁻/ʸ mice cause WT parabiotic partners to lose weight .

This approach, along with other methods such as cell-based screening assays and pharmacological studies with synthetic peptides, continues to be refined in the ongoing search for the elusive endogenous Brs3 ligand.

What phenotypic characteristics are observed in Brs3 knockout models?

Brs3 knockout (KO) mice develop a distinct metabolic phenotype characterized by:

  • Hyperphagia and obesity beginning at approximately 16 weeks of age

  • Hypertension

  • Disturbances in glucose metabolism

  • Increased feeding efficiency

  • Lower fasting metabolic rate

  • Hyperinsulinemia

Detailed studies have shown that hyperphagia in Brs3 KO mice results from an increase in meal size without a compensatory decrease in meal frequency, leading to increased total daily food intake . These mice also exhibit alterations in hypothalamic neuropeptide expression, including up-regulation of melanin-concentrating hormone receptor mRNA and enhanced hyperphagic response to exogenous melanin-concentrating hormone administration .

Pair-feeding experiments have demonstrated that when Brs3 KO mice are calorie-restricted to match the intake of wild-type controls, their body weights normalize, although some metabolic abnormalities persist. While pair-feeding normalized plasma insulin levels, it failed to completely reverse increased adiposity and elevated leptin levels, suggesting an underlying metabolic dysregulation that contributes to or sustains the obese phenotype .

What are the validated methods for generating recombinant rat Brs3 for research studies?

Recombinant rat Brs3 can be generated through several approaches, with the most established method involving targeted gene expression in cell lines. Based on the search results, effective approaches include:

  • Cell line selection: Human non-small cell lung cancer cells (NCI-H1299) and Balb 3T3 cells have been successfully used for expressing recombinant Brs3 . The Balb 3T3 cell line is particularly valuable as it lacks endogenous Brs3, providing a clean background for pharmacological studies.

  • Gene cloning and expression: The full-length rat Brs3 cDNA can be cloned and inserted into appropriate expression vectors under the control of strong promoters (such as CMV) to ensure robust expression .

  • Verification of expression: Successful expression should be confirmed through techniques such as RT-PCR, Western blotting, or receptor binding assays. Functional assays, such as measuring inositol phosphate formation in response to potential ligands, can validate the activity of the recombinant receptor .

These approaches enable the production of sufficient quantities of recombinant rat Brs3 for detailed pharmacological characterization and ligand screening studies.

How can researchers effectively measure Brs3 activation and signaling in experimental systems?

Several validated methods can be used to measure rat Brs3 activation and downstream signaling:

  • Inositol phosphate formation assays: These assays measure the accumulation of inositol phosphates following G protein-coupled receptor activation and have been successfully used with recombinant Brs3 to assess receptor activation by potential ligands .

  • Guanosine 5'-(beta,gamma-imido)triphosphate (GppNHp) binding inhibition: This technique assesses changes in receptor affinity states upon G-protein coupling and has been shown to inhibit ligand binding to Brs3-expressing cells due to changes in receptor affinity .

  • Calcium mobilization assays: Since Brs3 couples to Gq proteins, calcium flux measurements using fluorescent indicators can provide real-time data on receptor activation.

  • Receptor binding assays: Using radiolabeled ligands such as [125I-D-Tyr6,beta-Ala11,Phe13,Nle14]Bn-(6-14), researchers can quantitatively assess binding affinity and receptor density in cells expressing recombinant rat Brs3 .

  • Downstream signaling pathway analysis: Techniques such as Western blotting for phosphorylated kinases (ERK1/2, PKC) can provide insights into the activation of signaling cascades downstream of Brs3.

When designing these assays, researchers should be mindful of the pharmacological differences between rat and human Brs3, as ligands effective for the human receptor may have substantially reduced potency for the rat variant .

What are the most effective strategies for generating Brs3 knockout models?

The generation of Brs3 knockout models can be accomplished through several approaches, with targeted mutagenesis in embryonic stem cells being the most established method. Based on the search results, an effective protocol includes:

  • Targeted disruption strategy: Homologous recombination can be used to disrupt the Brs3 coding region. In previous studies, this was achieved by replacing exon 2 with a Neo sequence . This approach targets the functional domain of the receptor, ensuring complete loss of expression.

  • Verification of targeted disruption: Correctly targeted embryonic stem cell clones should be identified through Southern analysis with flanking probes and by long-range PCR at the junction sites . Germline transmission can be confirmed by Southern analysis, with distinct fragment patterns differentiating the wild-type and mutant alleles.

  • Genotyping approach: Offspring can be genotyped using PCR with oligonucleotide pairs that distinguish between wild-type and mutant alleles .

  • Confirmation of Brs3 loss: Complete loss of Brs3 expression should be confirmed by RT-PCR analysis of brain mRNA, looking for the absence of Brs3 products spanning the targeted exons .

  • Backcrossing: For consistent experimental results, knockout mice should be backcrossed to the desired strain (e.g., C57BL/6J) for at least eight generations to minimize genetic background effects .

This methodology has successfully produced Brs3-deficient mice that develop the characteristic phenotype of hyperphagia, obesity, and metabolic disturbances, providing valuable models for studying Brs3 function .

How should researchers interpret contradictory findings regarding Brs3 function across different species?

The interpretation of contradictory findings regarding Brs3 function across species requires careful consideration of several factors:

  • Species-specific pharmacology: The marked pharmacological differences between rat and human Brs3, despite 80% sequence identity, highlight the need for species-specific validation of experimental findings . Researchers should recognize that ligand potency and receptor activation may vary significantly across species due to structural differences, particularly in the third extracellular loop (E3).

  • Contextual expression patterns: While Brs3 expression patterns show similarities across species, there may be subtle differences in distribution or expression levels that influence function. Initial characterizations reported limited CNS distribution, but subsequent analyses demonstrated wider expression patterns , suggesting that apparent contradictions may result from incomplete characterization.

  • Methodological considerations: Different experimental approaches (in vitro vs. in vivo, knockout vs. knockdown, acute vs. chronic interventions) may yield seemingly contradictory results. For instance, while acute pharmacological inhibition may produce different effects than germline knockout models, both approaches provide valuable complementary insights.

  • Developmental compensation: Germline knockout models may develop compensatory mechanisms that mask or alter the phenotypic expression of Brs3 deficiency, potentially leading to results that contradict those from acute intervention studies.

When faced with contradictory findings, researchers should systematically evaluate these factors and consider employing multiple complementary approaches to develop a more comprehensive understanding of Brs3 function.

What statistical approaches are most appropriate for analyzing complex phenotypes in Brs3 research?

The complex phenotypes associated with Brs3 function require sophisticated statistical approaches:

  • Multivariate analysis: Given that Brs3 manipulation affects multiple interconnected parameters (body weight, food intake, glucose metabolism, etc.), multivariate statistical methods that can account for these relationships are particularly valuable.

  • Repeated measures analysis: For longitudinal studies tracking phenotypic changes over time (such as the development of obesity in Brs3 KO mice), repeated measures ANOVA or mixed-effects models are appropriate for capturing time-dependent effects.

  • Pair-wise comparisons with appropriate controls: When evaluating specific aspects of the phenotype, carefully designed comparisons between experimental groups are essential. For example, the comparison between Brs3⁻/ʸ-WT parabiotic pairs and WT-WT pairs, as well as within-pair comparisons, provided crucial insights into the potential existence of a circulating Brs3 ligand .

  • Power analysis and sample size determination: Given the variability in complex phenotypes, adequate sample sizes determined through power analysis are essential to detect biologically meaningful effects reliably.

  • Integration of multiple endpoints: Correlational analyses between different phenotypic measures (e.g., food intake, body weight, adiposity, insulin levels) can reveal important relationships and provide insights into underlying mechanisms.

These approaches, combined with appropriate experimental design, can help researchers untangle the complex relationships between Brs3 function and metabolic phenotypes.

How can researchers reconcile the apparent contradiction between binding affinity data and functional outcomes in Brs3 studies?

Reconciling discrepancies between binding affinity data and functional outcomes in Brs3 studies requires consideration of several factors:

  • Receptor states and coupling efficiency: Binding affinity measures direct ligand-receptor interaction but doesn't necessarily predict functional outcomes, which depend on receptor activation and coupling to downstream effectors. For instance, GppNHp inhibits binding to Brs3-expressing cells due to changes in receptor affinity states , illustrating the dynamic relationship between binding and function.

  • Species-specific differences: The dramatic difference in potency of synthetic peptides like dY-bombesin between rat and human Brs3 demonstrates how minor sequence variations can profoundly affect functional outcomes despite similar binding characteristics.

  • Partial agonism/antagonism: Some ligands may bind with high affinity but act as partial agonists or even antagonists, leading to discrepancies between binding data and functional responses.

  • Receptor reserve and signal amplification: In systems with high receptor expression or efficient coupling, submaximal receptor occupancy may produce maximal responses, obscuring the relationship between binding affinity and functional outcomes.

  • Assay-specific factors: Different functional assays (calcium mobilization, inositol phosphate formation, ERK phosphorylation) may yield varying results due to differences in signal amplification, temporal resolution, and sensitivity.

When confronted with such discrepancies, researchers should employ multiple complementary assays measuring different aspects of receptor function and consider the biological context of their experimental system.

What are the most promising approaches for identifying the endogenous ligand(s) for Brs3?

Despite extensive research, the endogenous ligand(s) for Brs3 remain elusive. Several promising approaches for future research include:

  • Advanced metabolomic screening: Comprehensive metabolomic analysis of tissues where Brs3 is expressed, combined with functional screening of identified metabolites, may identify novel candidate ligands.

  • Refined parabiosis studies: Building on previous parabiosis experiments , researchers might employ more sensitive detection methods or modified experimental designs to detect subtle effects of circulating factors.

  • Genetic approaches: Systematic genetic screening to identify genes whose products interact with Brs3, potentially through CRISPR-based techniques, could reveal pathways leading to endogenous ligand identification.

  • Computational modeling and virtual screening: Advanced molecular modeling of the Brs3 binding pocket, informed by the known structural differences between species , could guide the identification of potential endogenous ligands.

  • Tissue-specific conditional knockout studies: Generating tissue-specific Brs3 knockout models may help identify tissues where Brs3 signaling is most critical, potentially narrowing the search for endogenous ligands to specific anatomical regions.

These approaches, especially when used in combination, offer promising avenues for resolving one of the most significant mysteries in bombesin receptor biology.

How might understanding Brs3 function contribute to therapeutic strategies for metabolic disorders?

The involvement of Brs3 in energy homeostasis and metabolic regulation suggests several potential therapeutic applications:

  • Novel anti-obesity approaches: Given that Brs3 knockout leads to hyperphagia and obesity , Brs3 agonists might represent a novel class of anti-obesity therapeutics targeting both food intake and energy expenditure pathways.

  • Glucose metabolism modulation: The disturbances in glucose metabolism observed in Brs3 KO mice suggest that Brs3 modulation might benefit patients with type 2 diabetes or insulin resistance.

  • Integrated approaches to metabolic syndrome: Since Brs3 deficiency affects multiple components of metabolic syndrome (obesity, glucose intolerance, hypertension), therapeutics targeting this receptor might provide integrated approaches to treating this multifaceted condition.

  • Personalized medicine applications: Understanding how genetic variations in Brs3 contribute to individual susceptibility to metabolic disorders could inform personalized therapeutic strategies.

  • Developmental interventions: The age-dependent onset of obesity in Brs3 KO mice (approximately 16 weeks) suggests critical developmental windows where Brs3-targeted interventions might be most effective.

Advancing our understanding of Brs3 function through continued basic and translational research will be essential for realizing these therapeutic possibilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.