Recombinant Rat Brain protein 44-like protein (Brp44l)

What is Brain Protein 44-Like (Brp44L) and what is its primary function?

Brp44L, also known as Mitochondrial Pyruvate Carrier 1 (MPC1), is a 109 amino acid mitochondrial protein belonging to the UPF0041 family. It functions as a critical component of the mitochondrial pyruvate carrier complex, which facilitates the transport of pyruvate from the cytosol into the mitochondrial matrix for oxidation. This protein plays an essential role in cellular energy metabolism by controlling the entry of a key substrate into the tricarboxylic acid (TCA) cycle . The functional protein was discovered in 2012 through studies in Drosophila and mouse models, where it was shown that MPC1 mutations severely impair mitochondrial pyruvate import .

What are the common synonyms and identifiers for Brp44L?

Brp44L is known by several alternative names and identifiers in scientific literature:

• Mitochondrial Pyruvate Carrier 1 (MPC1)

• Apoptosis-regulating basic protein

• Brain protein 44-like protein

• HSPC040 protein

• CGI-129

The gene aliases include: 0610006G08Rik, 3830411I18Rik, Arbp, BRP44L, CGI-129, dJ68L15.3, HSPC040, MPC1, MPYCD, and PNAS-115. UniProt identifiers for this protein are Q9Y5U8 (Human), P63031 (Rat), and P63030 (Mouse) .

How can recombinant Brp44L protein be expressed and purified for research use?

Recombinant full-length rat Brp44L protein can be successfully expressed in E. coli expression systems. The mature protein (amino acids 2-109) can be fused to an N-terminal His tag to facilitate purification. The amino acid sequence for rat Brp44L is: AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA .

For optimal storage and stability, the purified protein should be:

• Lyophilized after purification

• Stored at -20°C/-80°C upon receipt

• Reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Supplemented with 5-50% glycerol for long-term storage

• Aliquoted to avoid repeated freeze-thaw cycles

What detection methods are available for quantifying Brp44L in biological samples?

Several detection methods can be employed to quantify Brp44L in experimental samples:

• Sandwich ELISA: Commercial kits offer high sensitivity (detection limit approximately 0.15 ng/mL) and excellent specificity for detection of MPC1/Brp44L in tissue homogenates. These assays typically employ a colorimetric detection method with a detection range of 0.15-10 ng/mL .

• Chemiluminescent Sandwich ELISA: An alternative to colorimetric detection, offering similar sensitivity with a detection range of 0.156-10 ng/mL .

• Western Blotting: Polyclonal antibodies are available that detect endogenous levels of total Brp44L protein in cell and tissue lysates .

Each of these methods requires appropriate sample preparation, with tissue homogenization being a critical step for consistent results.

How does inhibition of the mitochondrial pyruvate carrier affect neuronal metabolism and function?

Inhibition of the mitochondrial pyruvate carrier complex (containing Brp44L/MPC1) has substantial effects on neuronal metabolism and function. Treatment with the MPC inhibitor UK-5099 produces the following metabolic adaptations:

• Reduced pyruvate entry into mitochondria leads to compensatory metabolic reprogramming

• Total glutamate levels are reduced by approximately 50%

• Aspartate levels increase approximately twofold

• Increased glutamine uptake and carbon flux of glutamine-derived Acetyl-CoA to TCA cycle intermediates

• Diminished labeling of TCA cycle intermediates from glucose-derived carbon

These metabolic changes suggest that neurons shift to increased glutamate oxidation as an alternative carbon source for the TCA cycle when pyruvate import is blocked. This metabolic flexibility appears to be a cellular adaptation to compensate for the loss in pyruvate-based anaplerosis. Similar reciprocal regulation of pyruvate and glutamate oxidation has been observed in organotypic hippocampal slice cultures containing mixed neural cell types .

What are the neurological consequences of MPC1/Brp44L deficiency in mammalian models?

Paradoxically, despite the critical role of MPC1/Brp44L in energy metabolism, research indicates that neurons with MPC deficiency exhibit intrinsic hyperexcitability. This appears to be a consequence of impaired calcium homeostasis, which reduces M-type potassium channel function . The increased neuronal excitability suggests complex relationships between mitochondrial metabolism and neuronal electrical properties.

In humans, point mutations in MPC1 result in impaired pyruvate oxidation, with affected individuals presenting with a constellation of:

• Developmental abnormalities

• Neurological problems

• Metabolic deficits

In mice, complete knockout of MPC1 is embryonically lethal, highlighting its essential role in development .

What experimental approaches can be used to study the compensation mechanisms when MPC1/Brp44L function is impaired?

To investigate compensatory mechanisms activated when MPC1/Brp44L function is impaired, researchers can employ several complementary approaches:

• Metabolic Tracing Studies:

  • Use isotope-labeled substrates (e.g., [3-13C1] glucose or 13C-labeled glutamine)

  • Track the fate of labeled carbon atoms through metabolic pathways

  • Quantify changes in labeled metabolites using mass spectrometry or NMR

  • This approach has demonstrated increased glutamine-derived carbon flux to TCA cycle intermediates in MPC-inhibited neurons

• Comparative Metabolomics:

  • Profile TCA cycle intermediates, amino acids, and other metabolites

  • Compare normal vs. MPC-inhibited conditions

  • Identify shifts in metabolite pools that suggest alternative pathway utilization

• Genetic Manipulation Models:

  • Conditional knockout mouse models

  • RNA interference or CRISPR-based approaches for cell-specific MPC1 depletion

  • Cross-species complementation studies to assess functional conservation

• Electrophysiological Assessment:

  • Patch-clamp recordings to measure neuronal excitability

  • Calcium imaging to assess changes in calcium homeostasis

  • Investigation of ion channel function, particularly M-type potassium channels

• Dietary Intervention Studies:

  • Test ketogenic diet effects on MPC-deficient models

  • Compare standard diet (4.9% fat, 24% crude proteins, 29% starch) versus ketogenic diet (74.4% animal fat, 9.9% crude protein, 0.7% starch)

How do mutations in MPC1/Brp44L affect its interaction with other components of the mitochondrial pyruvate carrier complex?

MPC1/Brp44L functions as part of a heterodimeric complex with MPC2 (previously known as BRP44). The functional integrity of this complex is essential for pyruvate transport into mitochondria. Mutations in MPC1 can disrupt:

• Complex formation with MPC2

• Localization to the inner mitochondrial membrane

• Pyruvate binding capacity

• Channel opening and transport dynamics

Research approaches to study these interactions include:

• Co-immunoprecipitation studies to assess physical interactions

• Blue native PAGE to analyze intact complexes

• Mitochondrial import assays to assess localization

• Reconstitution of the complex in artificial membrane systems

• Site-directed mutagenesis to map critical interaction domains

Understanding these interactions is crucial as the compelling evidence for MPC function includes demonstration that expression of mammalian MPC1 and MPC2 in bacteria (Lactococcus lactis) confers pyruvate uptake activity characteristic of eukaryotic UK-5099-sensitive mitochondrial pyruvate import .

What is the relationship between MPC1/Brp44L and neurodegenerative conditions?

The relationship between MPC1/Brp44L and neurodegenerative conditions is an emerging area of research. Several lines of evidence suggest potential connections:

• Mitochondrial Dysfunction: Mitochondrial defects are common in neurodegenerative diseases, and altered pyruvate metabolism may contribute to these pathologies

• Calcium Dysregulation: MPC deficiency impairs calcium homeostasis, which can contribute to neuronal vulnerability in conditions like Alzheimer's and Parkinson's diseases

• Hyperexcitability: The paradoxical neuronal hyperexcitability seen in MPC-deficient neurons may promote excitotoxicity, a common mechanism in neurodegeneration

• Genetic Associations: The MPC1 gene maps to human chromosome 6, which also contains the PARK2 gene associated with Parkinson's disease

• Therapeutic Potential: Targeting the mitochondrial pyruvate carrier has been proposed as a neuroprotective strategy, suggesting its modulation could impact disease progression

What are the best practices for designing experiments to study Brp44L/MPC1 function?

When designing experiments to study Brp44L/MPC1 function, researchers should consider:

• Model Selection:

  • Cell lines: HEK293, neuronal cell lines (SH-SY5Y, Neuro2a)

  • Primary cultures: Neurons, astrocytes, mixed glial cultures

  • Ex vivo: Organotypic hippocampal slice cultures

  • In vivo: Conditional knockout mice (complete knockout is embryonically lethal)

• Functional Readouts:

  • Mitochondrial pyruvate uptake assays

  • Oxygen consumption rate measurements

  • Lactate/pyruvate ratio monitoring

  • TCA cycle intermediate profiling

  • ATP production assays

• Genetic Manipulation Approaches:

  • RNA interference: siRNA or shRNA knockdown

  • CRISPR/Cas9 genome editing for precise mutations

  • Overexpression studies with tagged constructs

  • Rescue experiments with wild-type or mutant variants

• Pharmacological Tools:

  • UK-5099: Specific MPC inhibitor

  • Control compounds to distinguish MPC-specific effects

• Statistical Considerations:

  • Sample size determination based on effect size

  • Appropriate statistical tests (t-test for two groups, ANOVA for multiple groups)

  • Data normality assessment (D'Agostino and Pearson test)

  • Significance reporting with appropriate p-value notation

How should researchers interpret conflicting data regarding MPC1/Brp44L function in different experimental systems?

When faced with conflicting data regarding MPC1/Brp44L function across experimental systems, researchers should systematically evaluate:

• Cell and Tissue Specificity:

  • Different cell types may have varying metabolic profiles and compensation mechanisms

  • Neurons rely heavily on mitochondrial metabolism while other cells may be more glycolytic

  • Expression levels of MPC1/MPC2 may vary across tissues, affecting outcomes

• Methodological Differences:

  • Acute vs. chronic inhibition/depletion approaches

  • Complete knockdown vs. partial inhibition

  • Developmental timing of interventions

  • In vitro vs. ex vivo vs. in vivo systems

• Metabolic Context:

  • Substrate availability in experimental media

  • Oxygen levels (normoxia vs. hypoxia)

  • Fasting/fed state of organisms in in vivo studies

  • Diet composition (standard vs. ketogenic)

• Genetic Background Effects:

  • Different strain backgrounds in rodent models

  • Genetic drift in cell lines

  • Compensatory gene expression changes

• Validation Approaches:

  • Use multiple complementary techniques to confirm findings

  • Perform rescue experiments with wild-type protein

  • Confirm phenotypes with both genetic and pharmacological approaches

  • Test hypotheses across different experimental systems

What are the key considerations for using recombinant Brp44L protein in structural and interaction studies?

When using recombinant Brp44L protein for structural and interaction studies, researchers should consider:

• Protein Quality Control:

  • Verify purity (>90% by SDS-PAGE)

  • Confirm proper folding using circular dichroism

  • Assess aggregation state using dynamic light scattering

  • Validate function through biochemical assays

• Expression and Purification Strategy:

  • E. coli expression systems are suitable for producing functional protein

  • N-terminal His-tagging facilitates purification without interfering with function

  • Consider whether to include or cleave tags for downstream applications

  • Buffer optimization to maintain stability

• Reconstitution Approaches:

  • Lyophilized protein should be reconstituted in deionized sterile water

  • Recommended concentration: 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage stability

  • Avoid repeated freeze-thaw cycles

• Membrane Protein Considerations:

  • As a mitochondrial membrane protein, Brp44L may require appropriate detergents or lipid environments for native conformation

  • Consider reconstitution into liposomes or nanodiscs for functional studies

  • Evaluate effects of detergents on protein stability and activity

• Interaction Studies:

  • Co-expression with MPC2 may be necessary for certain functional studies

  • Control experiments with known interaction partners

  • Validate interactions using multiple complementary techniques (pull-down, SPR, ITC)

What emerging technologies could advance our understanding of Brp44L/MPC1 biology?

Several emerging technologies hold promise for advancing our understanding of Brp44L/MPC1 biology:

• Cryo-Electron Microscopy:

  • Determination of high-resolution structures of the MPC complex

  • Visualization of conformational changes during transport

  • Structural basis for inhibitor binding and specificity

• Genome Editing with Base Editors or Prime Editors:

  • Introduction of patient-specific mutations with minimal off-target effects

  • Creation of isogenic cell lines differing only in MPC1 status

  • Precise modeling of disease-associated variants

• Single-Cell Metabolomics:

  • Profiling metabolic heterogeneity in MPC-deficient populations

  • Correlation of metabolic phenotypes with cellular outcomes

  • Identification of compensatory pathways at single-cell resolution

• Live-Cell Metabolic Imaging:

  • Genetically encoded sensors for pyruvate, lactate, and TCA cycle intermediates

  • Real-time visualization of metabolic flux changes

  • Spatial distribution of metabolic activities within neurons

• Mitochondrial Proteomics and Interactomics:

  • Comprehensive mapping of MPC1 interactome

  • Changes in mitochondrial protein composition in response to MPC deficiency

  • Post-translational modifications regulating MPC function

How might therapeutic targeting of the MPC complex influence neurological disorders?

Targeting the MPC complex represents a potential therapeutic strategy for neurological disorders through several mechanisms:

• Neuroprotective Effects:

  • MPC inhibition may force neurons to utilize alternative substrates like glutamine

  • Metabolic rewiring could potentially protect against certain forms of neuronal injury

  • Modulation of neuronal excitability through effects on calcium homeostasis and M-type potassium channels

• Metabolic Reprogramming:

  • Strategic MPC modulation could normalize aberrant metabolism in disease states

  • Counteracting disease-specific metabolic defects

  • Enhancing metabolic flexibility of neurons under stress conditions

• Disease-Specific Applications:

  • Epilepsy: Addressing the paradoxical hyperexcitability in MPC-deficient neurons

  • Neurodegeneration: Potential applications in conditions with mitochondrial dysfunction

  • Metabolic encephalopathies: Targeted approaches for patients with MPC1 mutations

• Complementary Dietary Approaches:

  • Ketogenic diet (74.4% animal fat, 9.9% crude protein, 0.7% starch) may provide alternative substrates that bypass MPC dependency

  • Tailored amino acid supplementation to support metabolic adaptation

  • Combined pharmacological and nutritional interventions

• Delivery Challenges:

  • Developing blood-brain barrier penetrant MPC modulators

  • Cell type-specific targeting strategies

  • Temporal control of MPC activity to avoid adverse effects