Recombinant Rat Brain protein 44 (Brp44)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Brp44 (MPC2) is a 14 kDa transmembrane protein localized to the inner mitochondrial membrane. It forms a heterodimeric complex with MPC1 (Brp44L) to mediate pyruvate uptake. This complex is evolutionarily conserved across species, including humans, mice, and rats, with sequence identities exceeding 96% between rat and human orthologs . The recombinant rat version is engineered for research purposes, often with an N-terminal His tag to enable purification via affinity chromatography .

Key Aliases:

AliasGene SymbolUniProt ID
Brp44MPC2P38718 (Rat)
Mitochondrial Pyruvate Carrier 2

Functional Role

Brp44/MPC2 is indispensable for mitochondrial pyruvate transport, linking glycolysis to oxidative phosphorylation. Its dysfunction is associated with metabolic disorders, including mitochondrial pyruvate carrier deficiency .

Production and Biochemical Properties

Recombinant rat Brp44 is typically produced in E. coli or mammalian cells (e.g., HEK-293) with a His tag for purification. Key production details include:

PropertyValue
Expression SystemE. coli or HEK-293 cells
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ApplicationsSDS-PAGE, Western blotting, structural studies

Applications in Research

Recombinant Brp44 is utilized in diverse experimental contexts:

ApplicationDescriptionSources
SDS-PAGEUsed to validate protein expression and purity
Western BlottingDetects Brp44 in tissue lysates (e.g., mouse kidney, liver cancer)
Structural StudiesHomology modeling and docking studies to predict ligand interactions (e.g., folic acid)
Antibody ValidationServes as a control for anti-MPC2 antibodies in IHC and IF/ICC

Metabolic Regulation

  • Brp44/MPC2 forms a heterodimer with MPC1, enabling pyruvate entry into mitochondria. This complex is a target for thiazolidinediones (TZDs), a class of insulin-sensitizing drugs .

  • Knockdown of MPC2 in human cells disrupts mitochondrial respiration, underscoring its role in energy metabolism .

Cross-Species Functional Conservation

  • Human BRP44 (MPC2) restores growth defects in yeast Δfmp43 strains, demonstrating functional conservation between species .

  • Homology modeling predicts binding sites for small molecules like folic acid (FA), which may modulate Brp44 activity .

Disease Association

  • While Brp44 itself is not directly linked to disease, mutations in the MPC complex (MPC1/MPC2) cause mitochondrial pyruvate carrier deficiency, a severe metabolic disorder .

Data Tables

Table 2: Applications of Recombinant Brp44 in Studies

ApplicationMethodKey Findings
Functional ConservationYeast complementationHuman BRP44 restores growth in Δfmp43 yeast
Ligand BindingMolecular dockingFA binds to Brp44’s predicted binding sites
Antibody ValidationWestern blottingDetects MPC2 in mouse kidney and liver cancer tissues

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mpc2; Brp44; Mitochondrial pyruvate carrier 2; Brain protein 44; Protein 0-44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Mpc2
Target Protein Sequence
MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWKYNQE LKSKGIQ
Uniprot No.

Target Background

Function
This protein mediates the uptake of pyruvate into mitochondria.
Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Liver, kidney, and brain.

Q&A

What is Brain Protein 44 (Brp44) and what is its current nomenclature in scientific literature?

Brain Protein 44 (Brp44) has been reclassified as Mitochondrial Pyruvate Carrier 2 (MPC2) following groundbreaking research in 2012 that identified its function. Similarly, the related Brain Protein 44-like (Brp44L) is now known as Mitochondrial Pyruvate Carrier 1 (MPC1). These proteins were simultaneously identified by the laboratories of Rutter and Martinou while studying conserved paralogues with previously unknown function . The identification involved comprehensive cellular, biochemical, and functional analyses that demonstrated the crucial role of these proteins in mitochondrial pyruvate import. Prior to this discovery, these proteins belonged to the UPF0041 family with unclear functions .

How is Brp44 structurally characterized in rats compared to human orthologs?

Rat Brp44 shares significant sequence homology with its human ortholog. Specifically, the recombinant protein control fragments of the human BRP44L show 74% sequence identity with the corresponding rat ortholog . This high degree of conservation suggests the functional importance of this protein across mammalian species. The rat Brp44 maintains the core structural features required for its function as a component of the mitochondrial pyruvate carrier complex, though species-specific variations may contribute to subtle differences in regulatory mechanisms or binding affinities.

What experimental methods are recommended for confirming the purity and identity of recombinant Rat Brp44?

For recombinant Rat Brp44 validation, a multi-method approach is recommended:

  • Western Blotting: Utilizing specific antibodies against Rat Brp44, with recombinant protein fragments serving as controls. Pre-incubation of antibody-protein control fragment mixtures (at 100x molar excess based on concentration and molecular weight) for 30 minutes at room temperature is advised for blocking experiments .

  • Mass Spectrometry: Tandem mass tag (TMT)-based quantitative mass spectrometry has proven effective in identifying and quantifying Brain Protein 44 in rat brain samples, as demonstrated in recent proteomics studies .

  • Functional Assays: Measuring UK-5099-sensitive pyruvate transport activity in reconstituted systems, similar to the approaches used in the original identification studies where mammalian MPC proteins expressed in Lactococcus lactis conferred characteristic pyruvate uptake activity .

What is the expression pattern of Brp44 across different rat brain regions?

Brp44 expression varies across rat brain regions, reflecting its importance in energy metabolism of neurons. Deep proteomic profiling of rat brain tissue has revealed strain-specific variations in Brp44 expression levels . Comprehensive proteomics studies conducted across multiple rat strains have identified Brp44 among thousands of quantified proteins in the brain. The expression levels show correlations with energy metabolism pathways and can be strain-dependent, suggesting genetic regulation of its expression. Regional variation in expression likely corresponds to the metabolic demands of different neuronal populations, with regions of high metabolic activity showing elevated expression levels.

How do rat strain differences affect Brp44 expression and function?

Significant variations in protein expression have been observed between different rat strains, particularly between the SHR/Olalpcv and BN-Lx/Cub parental strains and their recombinant inbred offspring . These strain differences are governed by protein expression quantitative trait loci (pQTLs), which have been identified through comprehensive proteogenomic analyses. The expression differences can be attributed to genetic variants including non-synonymous mutations and structural variations in the genome that affect protein functionality or abundance. For researchers working with rat models, considering strain-specific expression patterns is crucial when designing experiments related to Brp44 function or when using it as a biomarker.

What subcellular fractionation methods are most effective for isolating mitochondria to study native Rat Brp44?

For optimal isolation of mitochondria containing native Rat Brp44:

  • Differential Centrifugation with Percoll Gradient: Begin with gentle tissue homogenization in isotonic buffer (250 mM sucrose, 10 mM HEPES, 1 mM EDTA, pH 7.4), followed by low-speed centrifugation (1,000×g) to remove nuclei and debris. The supernatant should undergo medium-speed centrifugation (10,000×g) to pellet mitochondria, which can then be further purified on a Percoll gradient.

  • Immunocapture Techniques: Using antibodies specific to mitochondrial outer membrane proteins to isolate intact mitochondria while preserving membrane protein complexes.

  • Functional Integrity Verification: Assessment of mitochondrial membrane potential and respiratory capacity is essential to confirm that isolated mitochondria retain functional Brp44/MPC complexes. This can be accomplished using fluorescent probes such as TMRM or JC-1 in combination with respirometry to measure pyruvate-dependent oxygen consumption.

How does Brp44 contribute to brain energy metabolism in different physiological states?

As a component of the mitochondrial pyruvate carrier (MPC), Brp44 plays a critical role in neuronal energy metabolism by facilitating the transport of pyruvate from the cytosol into the mitochondrial matrix where it can enter the TCA cycle . This transport is particularly important under different physiological conditions:

  • Normal Physiological State: Brp44/MPC mediates the primary entry of glucose-derived carbon into the mitochondrial TCA cycle via pyruvate, supporting ATP production through oxidative phosphorylation.

  • Metabolic Stress Conditions: When pyruvate availability is limited, neurons can adapt by utilizing alternative substrates. Research has shown that rat cortical neurons can maintain viability for extended periods even when pyruvate oxidation is reduced by more than half through MPC inhibition . Under these conditions, neurons increase their utilization of alternative substrates such as leucine, β-hydroxybutyrate, and glutamine.

  • Excitotoxic Conditions: Interestingly, MPC inhibition has shown protective effects against excitotoxic neuronal death, suggesting a complex role in neuronal stress responses beyond simple energy provision .

What experimental approaches can measure Brp44-dependent pyruvate transport in isolated rat brain mitochondria?

For quantitative assessment of Brp44-dependent pyruvate transport:

  • Radioisotope Flux Measurements: Using [14C]-labeled pyruvate to track transport rates into isolated mitochondria, with specific inhibition by UK-5099 serving as a control for MPC-mediated transport.

  • Membrane Potential-Dependent Assays: Since pyruvate transport via MPC is influenced by the mitochondrial membrane potential, simultaneous measurement of membrane potential and pyruvate-dependent oxygen consumption can provide insights into transport kinetics.

  • Metabolic Flux Analysis: Stable isotope tracing with labeled glucose (e.g., [3-13C1] glucose) can track carbon flux through pyruvate into TCA cycle intermediates, with UK-5099 treatment serving to distinguish MPC-dependent from MPC-independent metabolic pathways .

  • Reconstitution Studies: For direct functional assessment, recombinant Rat Brp44 can be reconstituted with its partner MPC1 in liposomes to measure pyruvate transport activity in a defined system.

How do alternative substrates compensate for reduced pyruvate transport in conditions of Brp44/MPC inhibition?

When Brp44/MPC function is inhibited (e.g., by UK-5099), neurons demonstrate remarkable metabolic flexibility through several compensatory mechanisms:

What genetic factors regulate Brp44 expression in rat brain tissue?

The expression of Brp44 in rat brain is regulated by a complex interplay of genetic factors:

  • cis-acting Quantitative Trait Loci (pQTLs): Comprehensive proteomic studies across rat strains have identified specific genetic loci that regulate protein expression. In a study of 29 HXB/BXH recombinant inbred rat strains, 464 proteins were found to be linked to cis-acting pQTLs . While the specific pQTLs for Brp44 were not explicitly detailed in the search results, the study methodology provides a framework for identifying such regulatory elements.

  • Sex-specific Regulation: Proteomic analyses have revealed both shared and distinct cis-pQTLs between sexes, indicating that Brp44 expression may be differentially regulated in male and female rats . This sexual dimorphism in gene regulation has implications for sex-dependent differences in brain energy metabolism.

  • Structural Variants: Analysis using rat pangenome data has uncovered structural variants that influence protein expression. This emerging field of pangenomics enables the study of full genomes where all strains can be directly compared without reference bias, revealing complex variants between individuals that may affect Brp44 expression or function .

How can researchers identify and characterize variant peptides of Rat Brp44 using proteogenomic approaches?

A comprehensive proteogenomic approach for identifying variant peptides involves:

  • Integrated Genomic and Proteomic Analysis: Combining DNA sequencing data with tandem mass spectrometry (TMT-based LC-MS/MS) to identify variant peptides. This approach has successfully identified 95 variant peptides carrying non-synonymous variants in rat brain studies .

  • Custom Database Construction: Generating strain-specific protein databases that incorporate known genetic variants to enable the identification of variant peptides during proteomic analysis.

  • Validation of Variant Peptides: Confirming the presence of variant peptides through targeted mass spectrometry approaches such as parallel reaction monitoring (PRM) or multiple reaction monitoring (MRM).

  • Functional Impact Assessment: For identified variant peptides, in silico analysis can predict potential structural and functional impacts, which can then be validated through biochemical and functional assays.

What is the relevance of rat Brp44 research to human neurological disorders?

Research on rat Brp44 has significant translational potential for human neurological disorders:

  • Parkinson's Disease Models: MPC inhibition has shown protective effects in experimental models of neurotoxicity, particularly in Parkinson's disease models . This suggests that modulation of MPC activity, which involves Brp44, could represent a novel neuroprotective strategy.

  • Excitotoxic Neuronal Death: MPC inhibition has demonstrated protection against excitotoxic neuronal death, a process implicated in various acute and chronic neurological conditions including stroke, traumatic brain injury, and neurodegenerative diseases .

  • Cross-species Conservation: The high degree of sequence homology between rat and human Brp44 (MPC2) suggests conserved functions. Human BRP44L shows 74% sequence identity with the corresponding rat ortholog , indicating that findings in rat models may have direct relevance to human physiology and pathology.

  • Genetic Associations: The human gene encoding BRP44L maps to chromosome 6, a region associated with several neurological conditions. Notably, the PARK2 gene, which is associated with Parkinson's disease, is located on chromosome 6 . While not directly linked, the proximity and potential regulatory relationships make rat Brp44 research potentially informative for understanding these human conditions.

What are the most effective protocols for generating functional recombinant Rat Brp44 for structural studies?

For obtaining high-quality recombinant Rat Brp44 suitable for structural studies:

  • Expression System Selection: Bacterial expression systems often yield insufficient functional protein due to the membrane protein nature of Brp44. Insect cell (Sf9, High Five) or mammalian cell (HEK293F) expression systems are recommended for proper folding and post-translational modifications.

  • Construct Design: Including purification tags (His6, FLAG) at positions that don't interfere with protein folding or function. Creating fusion constructs with stabilizing proteins such as SUMO or GFP can improve expression and solubility.

  • Co-expression Strategy: Since Brp44 (MPC2) functions in a complex with MPC1, co-expression of both proteins is crucial for obtaining stable, functional complexes. This approach mimics the natural assembly of the MPC complex and enhances structural integrity.

  • Membrane Protein Solubilization: Careful selection of detergents is critical. Initial screening should include mild detergents like DDM, LMNG, or GDN that preserve protein-protein interactions within the MPC complex.

  • Functional Validation: Before proceeding to structural studies, reconstitution of purified recombinant protein into liposomes should demonstrate pyruvate transport activity that is sensitive to the specific inhibitor UK-5099 .

How can researchers design experiments to investigate the role of Brp44 in neuroprotection against oxidative stress?

A comprehensive experimental design to investigate Brp44's role in neuroprotection should include:

  • In Vitro Models of Oxidative Stress:

    • Primary rat cortical neuron cultures treated with oxidative stressors (H₂O₂, rotenone, MPP+)

    • Manipulation of Brp44 expression through overexpression, knockdown, or specific inhibition with UK-5099

    • Assessment of cell viability, ROS production, mitochondrial membrane potential, and ATP levels

  • Metabolic Adaptation Assessment:

    • Stable isotope tracing to track metabolic flux through alternative pathways during MPC inhibition

    • Quantification of changes in utilization of alternative substrates (leucine, β-hydroxybutyrate, glutamine)

    • Analysis of adaptive changes in gene expression using RNA-seq

  • Ex Vivo Brain Slice Models:

    • Organotypic hippocampal or cortical slice cultures exposed to oxygen-glucose deprivation

    • Treatment with MPC inhibitors before, during, or after insult to determine optimal intervention timing

    • Assessment of neuronal survival, electrophysiological function, and metabolic parameters

  • In Vivo Models:

    • Genetic manipulation of Brp44 expression in specific brain regions using viral vectors

    • Pharmacological modulation of MPC activity with timing relative to induced oxidative stress

    • Behavioral, histological, and biochemical assessment of neuroprotection

What advanced imaging techniques can be employed to visualize Brp44 distribution and dynamics in live neurons?

For advanced visualization of Brp44 in living neuronal systems:

  • Super-resolution Microscopy Approaches:

    • STED (Stimulated Emission Depletion) microscopy for visualizing Brp44 distribution within mitochondria at resolutions below the diffraction limit

    • PALM/STORM techniques to achieve single-molecule localization precision

    • Expansion microscopy to physically enlarge specimens while maintaining relative spatial relationships

  • Live-cell Imaging Strategies:

    • CRISPR-Cas9 mediated endogenous tagging of Brp44 with fluorescent proteins or self-labeling protein tags (HaloTag, SNAP-tag)

    • Dual-color imaging with mitochondrial markers to track dynamic changes in localization

    • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility and turnover rates

  • Functional Imaging Techniques:

    • Genetically encoded sensors for pyruvate, combined with Brp44 labeling

    • Simultaneous imaging of mitochondrial membrane potential (TMRM) and Brp44 distribution

    • Correlative light and electron microscopy (CLEM) to link functional observations with ultrastructural context

  • Proximity Labeling Approaches:

    • BioID or APEX2 fusion proteins to identify proximal interacting partners of Brp44 in specific subcellular contexts

    • Split-GFP complementation assays to visualize specific protein-protein interactions involving Brp44

How might modulation of Brp44/MPC activity be leveraged for neuroprotective therapies?

Based on emerging research, modulation of Brp44/MPC activity presents several promising therapeutic avenues:

What experimental contradictions exist in the literature regarding Brp44 function, and how might these be resolved?

Several experimental contradictions and knowledge gaps exist regarding Brp44 function:

  • Neuroprotection vs. Essential Metabolic Function: A primary contradiction lies in how inhibition of such a seemingly essential metabolic pathway (pyruvate transport) could be neuroprotective. This apparent paradox might be resolved through more detailed temporal studies examining short-term vs. long-term effects of MPC inhibition, and through investigation of hormetic effects where mild metabolic stress triggers protective mechanisms.

  • Tissue-Specific Responses: While inhibition of MPC is protective in neuronal models, the consequences in other tissues may differ substantially. Comparative studies across tissue types could help clarify these differential responses and identify neuron-specific adaptive mechanisms.

  • Conflicting Roles in Different Disease Models: The role of MPC in different neurological disorders may be contradictory, with some conditions potentially benefiting from inhibition and others from activation. Comprehensive studies across multiple disease models with standardized methodologies would help resolve these contradictions.

  • Methodological Resolution Approaches:

    • Development of more selective pharmacological tools for MPC modulation

    • Cell-type specific genetic manipulation of Brp44 expression in vivo

    • Advanced metabolic flux analysis to comprehensively track substrate utilization patterns

    • Integration of multiomics data (proteomics, transcriptomics, metabolomics) to build more complete models of MPC function in health and disease

What future research directions will advance our understanding of Brp44's role in brain health and disease?

Priority research directions to advance understanding of Brp44 include:

  • Expanded Genetic Studies:

    • Integration of emerging rat pangenome data to identify structural variants affecting Brp44 expression and function

    • Expansion of proteomic studies to include additional rat strains to overcome current sample size limitations

    • Investigation of sex-specific regulation patterns identified in current pQTL studies

  • Advanced Structural Biology:

    • Cryo-EM structures of the intact MPC complex containing Brp44 under different functional states

    • Structural changes induced by interaction with inhibitors, activators, or under different metabolic conditions

    • Structural basis for species-specific differences in MPC complex function

  • Translational Research:

    • Development of improved pharmacological tools for selective modulation of MPC activity

    • Investigation of the link between rat pQTLs and human disorders to enhance translational potential

    • Clinical correlation studies examining MPC component expression in human neurological disorder samples

  • Systems Biology Approaches:

    • Integration of proteogenomic data with metabolomic profiling to build comprehensive models of brain energy metabolism

    • Network analysis of protein-protein interactions involving Brp44 under different physiological and pathological conditions

    • Machine learning approaches to predict functional consequences of genetic variants affecting Brp44 expression or structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.