Recombinant Rat Brain protein I3 (Bri3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Brain Protein I3 (Bri3)

Recombinant Rat Brain Protein I3, commonly referred to as Bri3, is a protein that has garnered significant attention in neuroscientific research due to its role in the central nervous system (CNS) and its potential implications in neurodegenerative diseases. Bri3 is structurally similar to Bri2, another protein in the same family, but it exhibits distinct characteristics and functions, particularly in its interaction with amyloid proteins.

Structure and Function of Bri3

Bri3 is a 267-residue protein that includes several distinct regions: an N-terminal part, a transmembrane segment, a linker region, the BRICHOS domain, and a C-terminal segment . The BRICHOS domain is crucial for its chaperone activity, which helps prevent protein misfolding and aggregation. Unlike Bri2, Bri3 is exclusively expressed in the CNS and its C-terminal segment is cleaved by furin, though the BRICHOS domain remains attached .

Role in Amyloid Protein Processing

Bri3 plays a significant role in modulating the processing of amyloid protein precursor (AβPP), which is a key component in the pathogenesis of Alzheimer's disease. Overexpression of Bri3 has been shown to reduce the cleavage of AβPP, thereby decreasing the levels of amyloid-beta (Aβ) peptides . This suggests that Bri3 could potentially mitigate the formation of amyloid plaques, a hallmark of Alzheimer's disease.

Comparison with Bri2

While both Bri2 and Bri3 contain the BRICHOS domain and share some functional similarities, they differ in their tissue expression and interaction with amyloid proteins. Bri2 is more efficient in reducing Aβ42 fibril formation compared to Bri3 . Additionally, Bri2 has been found in amyloid plaques in human Alzheimer's disease brains, indicating its potential role in disease pathology .

Potential Therapeutic Applications

Given its role in modulating amyloid protein processing and preventing protein aggregation, Bri3 could be a target for therapeutic interventions in neurodegenerative diseases. Further research is needed to fully explore its potential in this context.

References Nature: Recombinant Bri3 BRICHOS domain is a molecular chaperone with distinct properties compared to Bri2 BRICHOS. Colorectal Research: ELISA Recombinant Rat Brain protein I3(Bri3). Frontiers in Neuroscience: Transthyretin and BRICHOS: The Paradox of Amyloidogenic Proteins. NCBI Gene: BRI3 brain protein I3 [Homo sapiens (human)]. GeneCards: BRI3 Gene. Human Protein Atlas: Tissue expression of BRI3. Journal of Alzheimer's Disease: The Bri2 and Bri3 BRICHOS Domains Interact Differently with Aβ 42.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparations.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Bri3; Brain protein I3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Bri3
Target Protein Sequence
MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIH SRAVTRYPANSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNC GAVFT
Uniprot No.

Target Background

Function
Recombinant Rat Brain protein I3 (BRI3) participates in tumor necrosis factor-alpha (TNF)-induced cell death and may be a target of Wnt/β-catenin signaling in the liver.
Gene References Into Functions
  1. miR-323 may regulate ischemia/reperfusion-induced rat neuronal cell death by targeting BRI3. PMID: 26617783
Database Links
Protein Families
BRI3 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.