Recombinant Rat C-C chemokine receptor type 3 (Ccr3)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Recombinant Rat Ccr3 is a transmembrane G protein-coupled receptor (GPCR) with 359 amino acids and a molecular weight of ~41.6 kDa . Key features include:

PropertyDetails
Gene ID117027 (NCBI)
UniProt IDO54814
Detection Range (ELISA)0.312–20 ng/ml
Sensitivity (ELISA)0.183 ng/ml
Intra-/Inter-assay CV7.1% / 10.9%
ReactivityRat-specific
LigandsEotaxin (CCL11), MCP-3 (CCL7), MCP-4 (CCL13), RANTES (CCL5)
Signaling PathwaysGq-PLC-Ca²⁺, MAPK-P38-ERK

The receptor is expressed on eosinophils, basophils, dendritic cells (DCs), and Th2 cells, with intracellular pools enabling rapid surface mobilization during inflammation .

2.1. Disease Mechanisms

  • Allergic Asthma: CCR3 drives eosinophil recruitment to airways, exacerbating inflammation . Blocking CCR3 in rat models reduces airway hyperresponsiveness .

  • Autoimmune Disorders: Elevated CCR3 levels correlate with rheumatoid arthritis synovial fibroblast invasion and matrix metalloproteinase-9 (MMP-9) production .

  • HIV-1 Infection: Acts as a co-receptor for viral entry in CD4⁺ cells .

2.2. Pharmacological Studies

Recombinant CCR3 enables high-throughput screening for antagonists. For example:

  • SB328437: Inhibits eotaxin-induced MMP-9 upregulation in fibroblasts .

  • U0126: Blocks ERK signaling downstream of CCR3, reducing chemotaxis .

3.1. In Vitro Functional Assays

  • Chemotaxis: Mature dendritic cells exhibit dose-dependent migration to eotaxin (EC₅₀: 100 nM) .

  • Calcium Flux: CCR3 activation triggers intracellular Ca²⁺ release in mast cells, enhancing degranulation .

3.2. In Vivo Studies

  • Eosinophil Recruitment: CCR3-knockout rats show 70% reduced eosinophil infiltration in allergen-challenged lungs .

  • Neuroinflammation: CCR3⁺ T cells infiltrate aged rat brains, linking the receptor to cognitive decline .

Challenges and Future Directions

  • Donor Variability: CCR3 surface expression and chemotactic responses differ significantly between individuals .

  • Therapeutic Targeting: CCR3 antagonists show promise in preclinical models but face challenges in specificity due to receptor homology with other GPCRs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ccr3; Cmkbr3; C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; CD antigen CD193
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MASNEEELKTVVETFETTPYEYEWAPPCEKVSIRELGSWLLPPLYSLVFIVGLLGNMMVV LILIKYRKLQIMTNIYLLNLAISDLLFLFTVPFWIHYVLWNEWGFGHCMCKMLSGLYYLA LYSEIFFIILLTIDRYLAIVHAVLALRARTVTFATITSIITWGFAVLAALPEFIFHESQD NFGDLSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK AIQLIFVVMIVFFIFWTPYNLVLLLSAFHSTFLETSCQQSIHLDLAMQVTEVITHTHCCI NPIIYAFVGERFRKHLRLFFHRNVAIYLRKYISFLPGEKLERTSSVSPSTGEQEISVVF
Uniprot No.

Target Background

Function
CCR3 acts as a receptor for C-C type chemokines. It binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES (CCL5), and CCL15. Upon binding, it transduces a signal by increasing intracellular calcium ion levels. Additionally, it serves as a potential functional receptor for NARS1.
Gene References Into Functions
  1. CCR3 does not play a role in choroidal neovascularization development. PMID: 22183343
  2. Allergen-induced recruitment of eosinophils in the distal septum and turbinates reached its peak at 8 hours post-challenge, coinciding with a 2-4-fold increase in CCR3 and betac mRNA. PMID: 20696593
  3. Research has shown that CCR3 is absent from the testes. PMID: 11994538
  4. Downregulation of constitutively expressed surface CCR3 levels by interleukin 1-beta in an insulin-producing model system suggests receptor internalization for reuse or degradation, secretion, or both. PMID: 12004163
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in spleen but not in astrocytes or microglia.

Q&A

What is the basic structure and function of rat CCR3?

Rat CCR3 (also known as CD193, C-C CKR-3, and Cmkbr3) is a G protein-coupled receptor located in the cell membrane as a multi-pass membrane protein. Its primary function is to act as a receptor for C-C type chemokines, including eotaxin, MCP-3, MCP-4, and RANTES. When these ligands bind to CCR3, the receptor transduces signals by increasing intracellular calcium ion levels . CCR3 plays a critical role in mediating the chemotactic and activating effects of multiple chemokines on eosinophils and other immune cells .

Where is CCR3 typically expressed in rat models?

CCR3 shows expression in multiple cell types. It is predominantly expressed on eosinophils, where it mediates their recruitment and retention in inflamed tissues. Additionally, CCR3 is expressed on Th2 lymphocytes, mast cells, and structural cells including airway smooth muscle cells and airway epithelial cells . Recent research has also demonstrated CCR3 expression in microglia, suggesting a role in neuroinflammatory processes .

What are the standard methods to measure rat CCR3 levels in biological samples?

The most common methods for measuring rat CCR3 levels include:

  • ELISA (Enzyme-Linked Immunosorbent Assay): Sandwich ELISA kits are available with a detection range of 0.312-20 ng/ml and sensitivity of 0.183 ng/mL. These are suitable for measuring CCR3 in serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids .

  • Quantitative Real-Time PCR (RT-qPCR): This technique measures CCR3 mRNA expression using specific primers. RNA is extracted from tissues (commonly 30mg samples), converted to cDNA, and subjected to qPCR amplification. The 2^-ΔΔCT method is typically used to assess mRNA levels relative to housekeeping genes like GAPDH .

  • Immunofluorescence (IF) staining: This method allows visualization of CCR3 expression in specific cell types within tissue sections and can be particularly useful for assessing CCR3 expression in microglia and other cell populations .

What are the optimal experimental approaches for CCR3 knockdown in rat models?

For effective CCR3 knockdown in rat models, adeno-associated virus (AAV) vectors carrying CCR3-specific shRNA have been successfully employed. The methodological approach includes:

  • Vector Construction: Synthesize CCR3 shRNA sequences (e.g., 5′-CAGCTGGAAGCGTTTCCATGCTCTA-3′) and clone them into appropriate plasmids such as pHBAAV-U6-MCS-CMV-EGFP to produce pHBAAV-U6-MCS-CMV-EGFP-CCR3 shRNA. Include EGFP labeling for tracking .

  • Viral Packaging: Package the construct into AAV particles (typically AAV2/9) with genomic titers around 1.3×10^12 vg/mL, determined by quantitative PCR .

  • Stereotaxic Injection: For targeting brain regions such as the hippocampus, use stereotaxic coordinates (e.g., −4.24 mm anteroposterior, ±2 mm mediolateral from the bregma, and −3.5 mm dorsoventral from the dura mater surface). Inject 4 μL of virus bilaterally (2μL per side) at a rate of 200 nL/min .

  • Validation: Confirm knockdown efficiency through RT-qPCR, Western blot, and immunofluorescence staining approximately 3 weeks post-injection .

This approach has shown significant reduction in both mRNA and protein expression of CCR3, with functional consequences observed in behavioral and molecular assays .

How does CCR3 contribute to allergic inflammation in rat models?

CCR3 plays a multifaceted role in allergic inflammation, particularly in allergic rhinitis (AR) models:

  • Eosinophil Recruitment: CCR3 mediates the migration of eosinophils into inflammatory tissues by binding to eotaxins (members of the C-C chemokine family) .

  • Inflammatory Mediator Regulation: CCR3 gene knockout alleviates eosinophil invasion and inflammatory responses in AR models by reducing the expression levels of eosinophil granule proteins (EPO, ECP, MBP) and modulating immune factors .

  • Signal Transduction: Upon binding with chemokines, CCR3 initiates signal transduction pathways that activate eosinophils and enhance their effector functions in allergic responses .

  • Tissue Pathology: CCR3-mediated inflammation contributes to tissue pathology in allergic conditions, with CCR3 knockout models showing reduced inflammatory infiltrates and improved tissue architecture .

Research investigating AR models has demonstrated that targeting CCR3 could represent a potential therapeutic strategy for treating allergic conditions by interrupting the recruitment and activation of inflammatory cells .

What role does CCR3 play in viral infections, particularly RSV, and how can this be experimentally investigated?

CCR3 has a complex role in viral infections, particularly in respiratory syncytial virus (RSV) infection:

  • Facilitation of Viral Entry: CCR3 facilitates RSV infection of airway epithelial cells through direct interaction with the viral G protein .

  • Inhibition Mechanisms: This CCR3-mediated infection can be inhibited by eotaxin-1/CCL11 or by CCR3 gene silencing, suggesting competitive binding between viral proteins and natural ligands .

  • Immune Cell Recruitment: The RSV G protein-CCR3 interaction mediates selective chemotaxis of Th2 cells and eosinophils, potentially skewing the immune response toward a less effective antiviral state .

  • In Vivo Effects: Mice lacking CCR3 display significantly reduced RSV infection, airway inflammation, and mucus production, indicating that CCR3 contributes to pathology during infection .

Experimental approaches to investigate these interactions include:

  • In vitro binding assays between recombinant RSV G protein and CCR3

  • Viral infection assays with CCR3-expressing and CCR3-deficient cells

  • Chemotaxis assays to assess immune cell recruitment

  • In vivo infection studies using CCR3 knockout or knockdown models

Understanding this virus-receptor interaction may reveal potential therapeutic targets for RSV infections, which are particularly important in pediatric populations and may predispose to asthma later in life .

How can researchers reconcile the seemingly contradictory roles of CCR3 in immune protection versus pathology?

The dual roles of CCR3 in immune responses present a complex research challenge:

  • Pathological Role: CCR3 mediates recruitment of eosinophils and Th2 cells associated with allergic inflammation and tissue damage in conditions such as allergic rhinitis .

  • Protective Role: Recent studies suggest pulmonary eosinophils (which express CCR3) have dual outcomes:

    • One linked to RSV-induced airway inflammation and pulmonary pathology

    • Another with innate features that contribute to antiviral defense, potentially limiting virus-induced lung dysfunction

Methodological approaches to investigate this dichotomy include:

  • Temporal Analysis: Examining CCR3 function at different timepoints during disease progression

  • Context-Specific Knockdown: Using tissue-specific or inducible CCR3 knockdown approaches

  • Targeted Blocking Studies: Using specific antibodies or inhibitors to block CCR3 function at different disease stages

  • Omics Approaches: Employing transcriptomics and proteomics to characterize the downstream effects of CCR3 signaling in different inflammatory contexts

These contradictory roles suggest that therapeutic approaches targeting CCR3 may need to be precisely timed and contextualized to achieve beneficial outcomes without compromising protective immune functions .

What are the key controls needed when designing CCR3 knockdown experiments?

When designing CCR3 knockdown experiments, researchers should include these essential controls:

  • Negative Control Vector: Include a scrambled shRNA sequence (shNC) in the same vector backbone (e.g., AAV2/9-EGFP NC) to control for non-specific effects of viral transduction and shRNA expression .

  • Knockdown Validation: Confirm CCR3 knockdown efficiency at both mRNA (using RT-qPCR) and protein levels (using Western blot and immunofluorescence) to ensure sufficient gene silencing before proceeding with functional assays .

  • Timing Controls: Include experimental groups with different post-injection timepoints to determine the optimal time window for investigating CCR3 knockdown effects (typically 3 weeks post-injection for stable knockdown) .

  • Cell-Type Specificity: Use co-staining in immunofluorescence experiments to confirm which specific cell populations (e.g., microglia, eosinophils) are affected by CCR3 knockdown .

  • Functional Validation: Include relevant functional assays (e.g., Morris Water Maze for cognitive function, ELISA for inflammatory mediators) to correlate CCR3 expression levels with physiological outcomes .

Control TypeImplementation MethodPurpose
Negative ControlScrambled shRNA vectorControl for non-specific effects
Knockdown ValidationRT-qPCR, Western blot, IFConfirm knockdown efficiency
Timing ControlsMultiple timepoint groupsDetermine optimal experimental window
Cell-Type SpecificityCo-staining IFIdentify affected cell populations
Functional ValidationBehavioral tests, ELISACorrelate expression with outcomes

What are the optimal sample preparation techniques for analyzing CCR3 in different rat tissues?

Different rat tissues require specific preparation techniques for optimal CCR3 analysis:

  • Brain Tissue (e.g., Hippocampus):

    • For protein extraction: Homogenize tissue in RIPA buffer containing protease inhibitors, centrifuge at 12,000g for 15 minutes at 4°C, and collect supernatant

    • For RNA extraction: Homogenize 30mg tissue in Trizol reagent, follow with chloroform extraction and isopropanol precipitation

  • Blood/Serum Samples:

    • Collect blood via cardiac puncture under anesthesia

    • For serum: Allow blood to clot at room temperature for 30 minutes, then centrifuge at 3,000g for 15 minutes

    • For CCR3 measurement: Use sandwich ELISA with a detection range of 0.312-20ng/ml

  • Lung/Airway Tissue:

    • Flash-freeze tissue in liquid nitrogen immediately after collection

    • For immunohistochemistry: Fix tissue in 4% paraformaldehyde, embed in paraffin, and prepare 5μm sections

    • For single-cell preparations: Digest tissue with collagenase and DNase, followed by filtration through cell strainers

  • Nasal/Sinus Tissue (for allergic rhinitis models):

    • Prepare tissue homogenates in PBS with protease inhibitors

    • Centrifuge at 10,000g for 10 minutes and collect supernatant for protein analysis

    • For histological analysis: Fix in 10% neutral buffered formalin and process for H&E and immunohistochemical staining

Each tissue type requires specific considerations for preserving CCR3 protein integrity and RNA quality to ensure accurate analysis results.

What are the most sensitive techniques for detecting changes in CCR3 signaling pathways?

Several advanced techniques can be employed to detect subtle changes in CCR3 signaling pathways:

  • Calcium Flux Assays: Since CCR3 activation increases intracellular calcium levels, measuring calcium flux using fluorescent calcium indicators (Fluo-4 AM, Fura-2) provides a direct measure of receptor activation kinetics. This can be performed using flow cytometry or fluorescence microscopy with real-time imaging .

  • Phosphoprotein Analysis: Upon activation, CCR3 triggers phosphorylation cascades. Phospho-specific antibodies in Western blot or phosphoproteomic approaches can map the activation of downstream signaling molecules. Key phosphoproteins to monitor include MAPK, PKC, and PI3K pathway components .

  • Single-Cell RNA Sequencing: This technique enables comprehensive analysis of CCR3-dependent gene expression changes at the single-cell level, revealing heterogeneity in responses across different cell populations .

  • CRISPR-Cas9 Genome Editing: Creating precise mutations in CCR3 or its signaling components allows detailed structure-function analysis of signaling mechanisms .

  • Proximity Ligation Assays (PLA): These can detect protein-protein interactions between CCR3 and its signaling partners with high sensitivity, revealing the dynamics of signaling complex formation .

  • BRET/FRET Techniques: Bioluminescence/Fluorescence Resonance Energy Transfer enables real-time monitoring of CCR3 interactions with G proteins and other signaling molecules in live cells .

These techniques provide significant advantages over traditional methods by offering increased sensitivity, temporal resolution, and the ability to detect transient signaling events in physiologically relevant contexts.

How can researchers effectively investigate the interaction between CCR3 and viral proteins like RSV G protein?

Investigating CCR3-viral protein interactions requires specialized techniques:

  • Co-Immunoprecipitation (Co-IP): Using anti-CCR3 antibodies to pull down protein complexes, followed by Western blot detection of viral proteins (e.g., RSV G protein). This confirms direct binding between CCR3 and viral components .

  • Surface Plasmon Resonance (SPR): This technique measures binding kinetics and affinity between purified recombinant CCR3 and viral proteins in real-time, providing quantitative binding parameters (KD, kon, koff) .

  • Competitive Binding Assays: Using labeled CCR3 ligands (e.g., eotaxin-1/CCL11) and measuring displacement by viral proteins to determine binding site overlap and competitive interactions .

  • Mutagenesis Studies: Generating point mutations or deletion constructs in both CCR3 and viral proteins to map critical binding residues and domains. This can be combined with functional assays to correlate binding with biological effects .

  • In Situ Proximity Ligation Assay (PLA): This technique can visualize protein-protein interactions between CCR3 and viral proteins directly in infected cells or tissues, providing spatial information about where interactions occur .

  • Cryo-Electron Microscopy: For structural determination of CCR3-viral protein complexes at near-atomic resolution, revealing the molecular basis of interactions .

These approaches collectively provide comprehensive insights into how viral proteins like RSV G engage with CCR3 to facilitate infection and modulate immune responses, potentially revealing targets for therapeutic intervention.

How should researchers interpret conflicting data regarding CCR3's role in neuroprotection versus neuroinflammation?

Interpreting conflicting data on CCR3's role in the CNS requires careful consideration of several factors:

  • Context-Dependent Effects: CCR3 may have different functions depending on:

    • Disease stage (acute vs. chronic)

    • Brain region specificity

    • Surrounding cytokine/chemokine milieu

    • Age and sex of experimental animals

  • Cell-Type Specific Responses: CCR3 knockdown has been shown to attenuate neuroinflammation by regulating polarization of activated microglia, but effects may differ in other CNS cell populations. Researchers should employ cell-type specific markers when analyzing CCR3 functions .

  • Downstream Signaling Pathway Analysis: Examine whether CCR3 activates pro-inflammatory pathways (e.g., NF-κB) or neuroprotective pathways (e.g., BDNF/TrkB). Research has shown that CCR3 knockdown rescued decreased mRNA and protein expression of BDNF/TrkB, suggesting complex pathway interactions .

  • Experimental Model Considerations: Different stress models (e.g., prolonged underwater exercise vs. direct inflammatory stimuli) may reveal different aspects of CCR3 function. Researchers should consider whether their model primarily tests physical stress, hypoxia, or direct inflammatory responses .

  • Temporal Analysis: Incorporate time-course experiments to determine whether CCR3 has different roles at different stages of the inflammatory response or disease progression .

When encountering conflicting data, researchers should systematically document all experimental variables and consider designing experiments that directly test competing hypotheses about CCR3 function in specific neurological contexts.

What statistical approaches are most appropriate for analyzing CCR3 expression data across different experimental models?

When analyzing CCR3 expression data across different experimental models, researchers should consider these statistical approaches:

  • For Comparing Multiple Groups:

    • One-way ANOVA followed by appropriate post-hoc tests (Tukey, Bonferroni, or Dunnett's) for normally distributed data

    • Kruskal-Wallis followed by Dunn's test for non-normally distributed data

    • Include power analysis to determine appropriate sample sizes (typically n=6 per group is used in CCR3 studies)

  • For Time-Course Experiments:

    • Repeated measures ANOVA when analyzing the same subjects over time

    • Mixed-effects models to account for both fixed effects (experimental conditions) and random effects (individual variation)

  • For Correlation Analyses:

    • Pearson correlation for normally distributed data or Spearman rank correlation for non-parametric data when examining relationships between CCR3 levels and functional outcomes (e.g., behavioral tests, inflammatory markers)

  • For Multi-Parameter Data:

    • Principal Component Analysis (PCA) or other dimension reduction techniques when analyzing large datasets with multiple parameters

    • Hierarchical clustering to identify patterns in CCR3-related gene or protein expression across experimental conditions

  • For RT-qPCR Data Analysis:

    • The 2^-ΔΔCT method is commonly used to assess mRNA levels of CCR3 relative to housekeeping genes like GAPDH

    • Include multiple reference genes for normalization to improve reliability

Data should be presented with appropriate measures of central tendency and dispersion (mean ± SEM is commonly used in published CCR3 studies), and exact p-values should be reported for transparency .

How can findings from rat CCR3 studies be effectively translated to potential human applications?

Translating findings from rat CCR3 studies to human applications requires careful consideration of several factors:

  • Cross-Species Homology Analysis: Compare rat and human CCR3 sequence homology, expression patterns, and signaling pathways. While fundamental mechanisms are often conserved, species-specific differences may impact drug development and targeting strategies .

  • Validation in Human Samples/Models:

    • Test findings in human cell lines or primary cells expressing CCR3

    • Utilize humanized mouse models

    • Analyze CCR3 expression and function in human clinical samples (when available)

    • Compare data with existing human genetic studies of CCR3 polymorphisms

  • Consideration of Disease Heterogeneity: Human allergic and inflammatory disorders show greater heterogeneity than controlled animal models. Stratification approaches may be needed to identify subpopulations most likely to benefit from CCR3-targeted interventions .

  • Biomarker Development: Identify accessible biomarkers that correlate with CCR3 activity in rats and validate these in human samples. Potential biomarkers include:

    • Serum/plasma CCR3 levels

    • CCR3+ cell counts in peripheral blood

    • CCR3 ligand levels (eotaxins, etc.)

    • Downstream gene expression signatures

  • Consideration of Existing Therapeutics: Evaluate how findings relate to existing human therapeutics that may indirectly affect CCR3 function, which could guide combination therapy approaches or repurposing strategies .

These approaches help bridge the translational gap between rat models and human applications, increasing the likelihood that discoveries in rat CCR3 biology will lead to meaningful clinical advances.

What are the key considerations when designing CCR3 antagonists based on rat model findings?

Designing CCR3 antagonists based on rat model findings requires careful attention to several critical factors:

  • Target Specificity Analysis:

    • Evaluate cross-reactivity with other chemokine receptors (particularly CCR1, CCR2, CCR5) due to structural similarities

    • Account for species-specific differences in the CCR3 binding pocket between rat and human receptors

    • Consider potential off-target effects on other G protein-coupled receptors

  • Mechanism of Action Considerations:

    • Determine whether competitive antagonism, allosteric modulation, or biased agonism would be optimal

    • Consider the impact on different signaling pathways downstream of CCR3 activation

    • Evaluate potential for receptor internalization and downregulation

  • Context-Dependent Effects:

    • Consider disease-specific roles of CCR3 (e.g., different in allergic inflammation versus viral infection)

    • Account for potential different outcomes in acute versus chronic administration

    • Evaluate impact on beneficial versus pathological roles of CCR3-expressing cells

  • Pharmacokinetic/Pharmacodynamic (PK/PD) Considerations:

    • Optimize for appropriate tissue distribution (e.g., brain penetration for neuroinflammatory conditions, lung distribution for respiratory conditions)

    • Consider route of administration suited to target tissue

    • Evaluate appropriate dosing regimens based on receptor occupancy studies

  • Biomarker Integration:

    • Develop companion biomarkers to identify patients likely to respond

    • Include pharmacodynamic biomarkers to confirm target engagement

    • Consider potential resistance mechanisms that might emerge

These considerations help ensure that CCR3 antagonists developed from rat models will translate effectively to human applications with optimal efficacy and safety profiles.

What emerging technologies could enhance our understanding of CCR3 biology in rat models?

Several cutting-edge technologies show promise for advancing our understanding of CCR3 biology:

  • Single-Cell Multi-Omics: Combining single-cell transcriptomics, proteomics, and epigenomics to comprehensively profile CCR3-expressing cells and their responses to different stimuli. This approach can reveal previously unrecognized heterogeneity and functional states of CCR3+ cells .

  • CRISPR-Based Functional Genomics: High-throughput CRISPR screening to systematically identify genes that modify CCR3 function or expression. This can uncover novel regulatory pathways and potential therapeutic targets within the CCR3 signaling network .

  • Optogenetics and Chemogenetics: Selective activation or inhibition of CCR3-expressing cells in vivo with temporal precision to dissect their roles in disease pathogenesis across different timepoints and contexts .

  • Advanced Imaging Techniques:

    • Intravital microscopy to visualize CCR3+ cell trafficking in living animals

    • Super-resolution microscopy to study CCR3 nanoscale organization and clustering at the cell membrane

    • PET imaging with CCR3-specific tracers to monitor receptor expression and occupancy in vivo

  • Organ-on-Chip Technology: Microfluidic systems modeling complex tissues with CCR3-expressing cells to study their interactions under controlled conditions that better mimic in vivo environments than traditional cell culture .

  • Artificial Intelligence/Machine Learning: Computational approaches to integrate multi-dimensional CCR3 data and predict potential therapeutic targets or biomarkers based on pattern recognition across large datasets .

These technologies promise to provide unprecedented insights into CCR3 biology, potentially revealing new therapeutic opportunities and biomarkers for CCR3-related diseases.

What are the most promising therapeutic applications based on current rat CCR3 research?

Based on current rat CCR3 research, several promising therapeutic applications emerge:

  • Allergic Rhinitis and Asthma Treatments:

    • CCR3 antagonists could reduce eosinophil recruitment and activation in airways

    • Gene therapy approaches targeting CCR3 expression in airway cells

    • Combination therapies targeting CCR3 alongside existing treatments to enhance efficacy

  • Viral Infection Interventions:

    • Small molecule inhibitors disrupting CCR3-viral protein interactions (especially for RSV)

    • Peptide-based inhibitors mimicking CCR3 binding domains to compete with viral attachment

    • Targeting CCR3 to modulate immune responses during viral infections, potentially limiting immunopathology

  • Neuroinflammatory Disorder Treatments:

    • CCR3-targeted approaches for conditions involving cognitive impairment due to inflammation

    • Neuroprotective strategies based on CCR3 knockdown that showed rescue of BDNF/TrkB expression

    • Brain-penetrant CCR3 modulators for neurological conditions with inflammatory components

  • Precision Medicine Applications:

    • CCR3 expression or genetic variation as biomarkers to stratify patients for existing therapies

    • Development of companion diagnostics measuring CCR3 activity to predict treatment response

    • Targeted approaches for patients with specific CCR3-related immune profiles

  • Combination Therapy Approaches:

    • Synergistic targeting of CCR3 alongside other chemokine receptors or inflammatory mediators

    • Sequential therapy targeting different phases of inflammatory responses

    • Adjuvant approaches using CCR3 inhibition to enhance efficacy of existing treatments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.