Recombinant Rat C-X-C chemokine receptor type 2 (Cxcr2)

Shipped with Ice Packs
In Stock

Description

Ligand Binding and Activation

Recombinant Rat Cxcr2 interacts with multiple ligands, with varying affinities:

LigandEC<sub>50</sub> (nM)Biological RoleSource
CXCL1 (GRO-α)3.0Neutrophil chemotaxis, angiogenesis
CXCL2 (MIP-2)3.5Renal fibrosis, mitochondrial dysfunction
CXCL3 (CINC-3)7.0Neutrophil recruitment in lung injury
CXCL8 (IL-8)0.7Cross-species activation (human/rat)

Key Finding: CXCL2/CINC-3 induces tubular cell senescence via β-catenin-mediated mitochondrial dysfunction in rat kidneys .

Signaling Pathways

Cxcr2 activates two primary pathways:

  1. Gα<sub>i</sub>-Dependent Signaling

    • Inhibits adenylyl cyclase, reducing cAMP levels .

    • Triggers Ca<sup>2+</sup> flux via PLCβ activation, potentiating chemotaxis .

  2. β-Catenin Interaction

    • Drives cellular senescence and fibrosis by disrupting mitochondrial function (e.g., reduced TOMM20 expression) .

Renal Fibrosis

  • Model: Unilateral ureteral obstruction (UUO) in rats.

  • Results:

    • Cxcr2 inhibition via SB225002 reduced fibrosis markers (fibronectin: ↓47%, p < 0.01) and senescence (p16<sup>INK4A</sup>: ↓52%) .

    • Restored mitochondrial function (TOMM20 expression ↑1.8-fold) .

Pulmonary Host Defense

  • Model: Aspergillus fumigatus infection in neutrophil-depleted rats.

  • Results:

    • CXCR2 neutralization increased mortality (82% vs. 23% controls) and reduced neutrophil influx (↓64%) .

    • Constitutive CXCL2 expression enhanced fungal clearance (lung burden ↓75%) .

Lung Injury

  • Model: Acid-induced or Pseudomonas aeruginosa infection in rats.

  • Results:

    • GRO/CXCL1 and Cxcr2 co-localized in alveolar type II cells post-injury (immunofluorescence confirmed) .

Therapeutic Implications

  • Inhibitors: SB225002 (IC<sub>50</sub> = 22 nM for Cxcr2) attenuates fibrosis and senescence .

  • Gene Therapy: CXCL2 overexpression reduced fungal load in lungs by 75% .

Comparative Species Analysis

FeatureRat Cxcr2Human CXCR2
Chromosomal Location9q332q35
Ligand SpecificityCXCL1-3, CXCL5-8CXCL1-8, MIF
Neutrophil MigrationPTx-sensitive PTx-sensitive

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms retain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Cxcr2; Il8rb; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGEIRVDNFSLEDFFSGDIDSYNYSSDPPFTLSDAAPCPSANLDINRYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWIFGSFLCKV FSFLQEITFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCITMWFLSLVLSLPIF ILRTTVKANPSTVVCYENIGNNTSKWRVVLRILPQTYGFLLPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNIVLFTDTLMRTKLIKETCERQNEINKALEATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGSSSANTSTTL
Uniprot No.

Target Background

Function
CXCR2 acts as a receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. Binding of IL-8 to CXCR2 triggers neutrophil activation, mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high affinity binding to IL-8, as well as to CXCL3, GRO/MGSA, and NAP-2.
Gene References Into Functions
  1. These data suggest that disruptions in CXCL1/CXCR2 expression and neutrophil dynamics within the placental-fetal-brain axis may contribute to complications arising from chorioamnionitis. PMID: 29117499
  2. Elevated CXCR2 mRNA and protein levels were observed in the pulmonary tissue of a rat model of hepatopulmonary syndrome. PMID: 27879294
  3. Research indicates that upregulation of CXCL1 and CXCR2 may contribute to remifentanil-induced hypernociception by modulating spinal NR2B-containing NMDA receptor expression and phosphorylation in rats. PMID: 26724371
  4. GRK6 may play a crucial role in the peripheral mechanisms of neuropathic pain. Overexpression of GRK6 may offer a potential therapeutic strategy for neuropathic pain by inhibiting the CXCR2 signaling pathway. PMID: 27145805
  5. Studies suggest that acupuncture may enhance the number of implanted embryos in cases of embryo implantation failure, potentially through the upregulation of CXCL8 receptors CXCR1 and CXCR2 expression in the endometrium. PMID: 24496685
  6. These findings highlight the significant role of CXCR2 receptors in the development of oral squamous cell carcinoma. PMID: 21670971
  7. Treatment with IL8RA-endothelial cells (EC), IL8RB-EC, and IL8RA/IL8RB-EC significantly reduces neointima formation in carotid artery endothelial cells at 28 days post-injury. PMID: 22361324
  8. Inhibition of CXCR1 and CXCR2 chemokine receptors provides an effective anti-inflammatory and neuroprotective treatment following spinal cord injury. PMID: 20877331
  9. Data suggests that CXCR2 overexpression in peripheral T cells is dependent on intracerebral microglial TNF-alpha, and TNF-alpha primes T cell transendothelial migration in Alzheimer's disease. PMID: 18462836
  10. Research indicates that TII alveolar epithelial cells produce three major proinflammatory CXC chemokines (GRO, CINC-2alpha, and MIP-2) and their cognate receptor CXCR2. PMID: 12829448
  11. A specific CXCR2 antagonist, SB-332235, effectively inhibited cigarette smoke-induced neutrophilia in a dose-dependent manner. PMID: 15516486
  12. Neuronal CXCR2 immunoreactivity was detected in several brain areas and was observed to rapidly but transiently downregulate upon trauma. PMID: 16472549
  13. These findings underscore the involvement of CXCR2 in the pathophysiology of adjuvant-induced polyarthritis (AIA). PMID: 17891165
  14. CXCR2 activation may directly contribute to motor neuron degeneration. PMID: 18391506
  15. Results suggest that the CXCR2 and PI3Kgamma signaling pathway may represent a promising target for developing novel therapeutic strategies for human diseases characterized by vascular leakage. PMID: 19255141

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Rat CXCR2?

Rat CXCR2 is a 7-transmembrane G protein-coupled receptor activated by CXC chemokines containing the ELR (Glu-Leu-Arg) motif, including CXCL1 and CXCL2/3. It has a molecular mass of approximately 50 kDa as determined by Western blot analysis . Functionally, CXCR2 mediates diverse cellular responses upon activation, including neutrophil recruitment, chemotactic migration, degranulation, respiratory burst, phagocytosis, directed cell movement, integrin activation, and transmigration . CXCR2 is particularly notable for its critical role in mediating angiogenesis induced by ELR+ CXC chemokines, as demonstrated through both in vitro and in vivo studies .

Which cell types express CXCR2 in rat models?

CXCR2 expression has been identified in multiple cell types, not limited to immune cells as initially thought. Research has confirmed CXCR2 expression in:

  • Neutrophils (polymorphonuclear leukocytes or PMNs)

  • Microvascular endothelial cells (both lung-derived and dermal)

  • Bronchial epithelial cells

  • Pulmonary endothelial cells

The expression can be verified through multiple techniques including RT-PCR analysis for mRNA detection, Western blot analysis using specific antibodies against CXCR2, flow cytometry, and immunohistochemistry .

How does Rat CXCR2 compare to human CXCR2?

Rat CXCR2 functions similarly to human CXCR2 in mediating responses to ELR+ CXC chemokines, though with some species-specific differences. While human CXCR2 responds to CXCL8 (IL-8), rats do not express CXCL8 but instead produce functional homologs including CXCL1 (KC) and CXCL2/3 (MIP-2) . Studies have shown that the rat CXCL3 protein shares approximately 59% amino acid sequence identity with the human protein . Despite these differences, the fundamental mechanisms of receptor activation, internalization, and signal transduction appear to be conserved between species, making rat models valuable for studying CXCR2-mediated processes relevant to human disease .

What are the recommended methods for generating recombinant Rat CXCR2?

For generating cells expressing recombinant Rat CXCR2, researchers typically employ the following methodology:

  • Isolate total RNA from rat neutrophils

  • Amplify CXCR2 cDNA using RT-PCR with specific primers (similar to those used for human CXCR2: forward, 5′-GTC AGG ATC CAA GTT TAC CTC AAA AAT GG-3′, and reverse, 5′-CTT AGG TCG ACG GTC TTA GAG AGT AGT GG-3′)

  • Perform reverse-transcription at 42°C for 45 minutes, followed by denaturation at 94°C for 2 minutes

  • Conduct PCR amplification for approximately 40 cycles (94°C denaturation for 1 minute, 55°C annealing for 1 minute, and 68°C elongation for 2 minutes)

  • Purify the resulting PCR product (~1.1 kb)

  • Ligate into a suitable expression vector (such as pTARGET)

  • Transfect mammalian cells (e.g., 293 cells) using calcium phosphate transfection or alternative methods

  • Select G418-resistant colonies

  • Confirm CXCR2 expression using flow cytometry with monoclonal antibodies against rat CXCR2

This approach yields cells that stably express functional rat CXCR2 suitable for various experimental applications.

How can I quantitatively assess CXCR2 ligand binding and activation in rat models?

Quantitative assessment of CXCR2 ligand binding and activation can be accomplished through several complementary techniques:

Ligand Binding Assays:

  • Competitive binding assays using radiolabeled or fluorescently labeled ligands

  • Flow cytometry-based binding assays with fluorescently tagged CXCR2 ligands

Activation Assays:

  • Calcium flux assays to measure intracellular calcium mobilization

  • Chemotaxis assays using Boyden chambers or transwell systems

  • Western blotting for phosphorylated downstream signaling molecules

ELISA-Based Approaches:
ELISA kits can quantify CXCR2 ligands such as CXCL3/CINC-2 with high precision. For example, commercially available Rat CXCL3/CINC-2 alpha/beta ELISA kits demonstrate excellent precision metrics:

Intra-Assay PrecisionInter-Assay Precision
Sample1
n20
Mean (pg/mL)10.2
Standard Deviation1.1
CV%10.8

Recovery rates for various sample types:

Sample TypeAverage % RecoveryRange %
Cell Culture Supernates (n=4)10198-107
EDTA Plasma (n=6)9990-109
Heparin Plasma (n=6)112103-119
Serum (n=6)9793-102

These methods collectively provide robust quantitative data on CXCR2 function and activation .

What controls should be included when studying CXCR2 antibody specificity?

When validating CXCR2 antibodies for research applications, include these critical controls:

  • Positive Controls:

    • Known CXCR2-expressing cells (neutrophils, transfected cells over-expressing rat CXCR2)

    • Western blots should show the expected ~50 kDa band in these samples

  • Negative Controls:

    • Control-transfected cells lacking CXCR2 expression

    • Samples treated with blocking peptides specific to the antibody's epitope

  • Cross-Reactivity Controls:

    • Testing against related receptors (particularly CXCR1) to ensure specificity

    • Cells transfected with CXCR1 to verify absence of cross-reactivity

  • Functional Validation:

    • Verify antibody's ability to block ligand binding (using IL-8 or CXCL1/CXCL2)

    • Confirm inhibition of neutrophil migration in response to CXCR2 ligands both in vitro and in vivo

  • Species Specificity Controls:

    • When using antibodies raised against one species to detect CXCR2 in another, validate cross-species reactivity

How can CXCR2 knockout models be utilized to study receptor function in rat systems?

CXCR2 knockout (CXCR2-/-) rat models provide powerful tools for investigating receptor function through comparative phenotypic analysis. Key experimental approaches include:

  • Bone Marrow Chimera Studies:

    • Generate chimeric animals by lethally irradiating wild-type or CXCR2-/- recipients and reconstituting with CXCR2-/- or wild-type bone marrow

    • This approach allows discrimination between hematopoietic and non-hematopoietic CXCR2 functions

    • Research has revealed that CXCR2 expression on both hematopoietic and non-hematopoietic cells contributes to neutrophil recruitment in models of acute lung injury

  • Corneal Micropocket Assays:

    • Implant Hydron pellets containing angiogenic factors (bFGF, MIP-2, IL-8) into corneas of wild-type and CXCR2-/- rats

    • Quantitatively assess neovascular responses through parameters including vascularized area, regional vascular density, and total vascular density

    • CXCR2-/- models have demonstrated drastically reduced neovascular responses to ELR+ CXC chemokines compared to wild-type controls

  • Tissue-Specific Knockout Approaches:

    • Use Cre-loxP systems to generate tissue-specific CXCR2 knockout models (endothelial-specific, epithelial-specific)

    • These models help delineate cell type-specific contributions of CXCR2 to various physiological and pathological processes

What role does endothelial CXCR2 play in neutrophil recruitment during inflammation?

Endothelial CXCR2 plays a previously underappreciated but critical role in neutrophil recruitment during inflammatory responses, particularly in the lung:

  • Dual Function Model:
    Research using bone marrow chimeric mice has revealed that while neutrophil CXCR2 mediates chemotactic migration, endothelial CXCR2 is essential for multiple aspects of the recruitment cascade. Studies demonstrate that LPS-induced neutrophil recruitment to the lung is reduced by approximately 50% in wild-type mice reconstituted with CXCR2-/- bone marrow, indicating that non-hematopoietic CXCR2 expression accounts for a substantial portion of neutrophil recruitment capacity .

  • Vascular Permeability Regulation:
    Endothelial CXCR2 activation directly contributes to increased microvascular permeability during inflammation. LPS-induced increases in lung microvascular permeability (measured by Evans blue extravasation) require CXCR2 expression on non-hematopoietic cells, specifically endothelial cells .

  • Transendothelial Migration:
    Endothelial CXCR2 activation may modify the expression of adhesion molecules and junctional proteins, facilitating neutrophil adhesion and subsequent transendothelial migration .

This dual role of CXCR2 in both neutrophils and endothelial cells creates a coordinated system for efficient neutrophil recruitment during inflammatory responses .

What are the advanced methods for visualizing and quantifying CXCR2-mediated angiogenesis in vivo?

Advanced techniques for visualizing and quantifying CXCR2-mediated angiogenesis include:

  • Corneal Micropocket Assay:

    • Implant Hydron pellets containing angiogenic stimuli into rat corneas

    • Document neovascular responses using slit-lamp biomicroscopy

    • Quantify angiogenic responses through digital image analysis measuring:

      • Vascularized area (mm²)

      • Regional vascular density (vessels/mm²)

      • Total vascular density (percent vascularized area × regional vascular density)

    • This method allows direct comparison between wild-type and CXCR2-/- animals or testing of CXCR2 antagonists

  • Rat Corneal Micropocket Assay (CMP):

    • Similar to corneal micropocket assays but optimized for rat models

    • Particularly useful for testing neutralizing antibodies against CXCR2

    • Allows for quantitative assessment of the inhibitory effects of these antibodies on neovascularization induced by ELR+ CXC chemokines

  • Intravital Microscopy:

    • Enables real-time visualization of CXCR2-mediated vascular processes

    • Can be combined with fluorescently labeled cells or proteins to track migration and interaction events

    • Particularly valuable for studying the kinetics of neutrophil-endothelial interactions

How can I address poor expression or functionality of recombinant Rat CXCR2?

When facing challenges with recombinant Rat CXCR2 expression or functionality, consider these common issues and solutions:

  • Low Expression Levels:

    • Optimize codon usage for rat-specific expression

    • Test different promoters (CMV is effective for mammalian expression)

    • Use expression vectors containing neomycin resistance genes for stable transfection

    • Increase selection pressure gradually to obtain high-expressing clones

  • Protein Misfolding:

    • Adjust culture temperature (30-32°C may improve folding)

    • Include chaperone proteins in expression systems

    • Ensure proper disulfide bond formation for this 7-transmembrane receptor

  • Functional Assessment Issues:

    • Confirm receptor surface expression using flow cytometry before functional assays

    • Validate antibody specificity using appropriate controls

    • Ensure ligand quality and bioactivity (recombinant ligands may lose activity over time)

  • Verification Approaches:

    • Use RT-PCR to confirm mRNA expression (with appropriate controls excluding reverse transcriptase to rule out genomic DNA contamination)

    • Perform Western blot analysis looking for the characteristic ~50 kDa band

    • Conduct functional assays such as calcium flux or chemotaxis to confirm signaling capacity

What factors might explain discrepancies between in vitro and in vivo CXCR2 functional studies?

Researchers often encounter discrepancies between in vitro and in vivo CXCR2 studies due to several factors:

  • Microenvironmental Complexity:

    • In vivo systems contain multiple cell types that express CXCR2 (neutrophils, endothelial cells, epithelial cells) which create complex intercellular communication networks

    • Studies using bone marrow chimeras reveal that CXCR2 on both hematopoietic and non-hematopoietic cells contributes to neutrophil recruitment, a complexity difficult to model in vitro

  • Multifunctional Nature of CXCR2:

    • CXCR2 mediates distinct functions in different cell types

    • In endothelial cells, CXCR2 regulates permeability and angiogenesis

    • In neutrophils, CXCR2 primarily mediates chemotactic migration

    • These diverse functions may lead to seemingly contradictory results depending on the experimental focus

  • Receptor Desensitization Dynamics:

    • Upon activation, CXCR2 undergoes phosphorylation, leading to receptor desensitization and internalization

    • This process occurs differently in controlled in vitro environments versus complex in vivo settings with variable ligand gradients and continuous receptor cycling

  • Compensatory Mechanisms:

    • In vivo systems may develop compensatory pathways in response to CXCR2 deficiency or inhibition

    • These adaptations are typically absent in acute in vitro experiments

How can I distinguish between CXCR1 and CXCR2 mediated effects in rat models?

Distinguishing between CXCR1 and CXCR2 mediated effects requires strategic experimental approaches:

  • Ligand Selectivity:

    • While IL-8 binds both CXCR1 and CXCR2 with high affinity, GRO-α, -β, -γ, and ENA-78 bind only CXCR2 with high affinity

    • Design experiments using receptor-selective ligands:

      • CXCR2-selective: GRO-α, MIP-2, ENA-78

      • CXCR1/CXCR2 dual-active: IL-8

    • Compare cellular responses to selective versus non-selective ligands

  • Specific Neutralizing Antibodies:

    • Use validated antibodies with demonstrated specificity

    • Confirm antibody specificity through testing on cells overexpressing either CXCR1 or CXCR2

    • Validate that anti-CXCR2 antibodies do not cross-react with CXCR1 or prevent binding of IL-8 to CXCR1

  • Genetic Approaches:

    • Utilize CXCR2-/- models which specifically lack CXCR2 while maintaining CXCR1 function

    • Compare phenotypes between wild-type and knockout animals in response to various stimuli

    • This approach has been particularly valuable in distinguishing the role of CXCR2 in mediating angiogenesis induced by ELR+ CXC chemokines

  • Pharmacological Inhibitors:

    • Use receptor-specific antagonists with validated selectivity profiles

    • Conduct dose-response studies to identify concentrations that selectively inhibit one receptor versus the other

What are emerging strategies for targeting CXCR2 in inflammatory disease models?

Cutting-edge approaches for targeting CXCR2 in inflammatory diseases include:

  • Cell Type-Specific Targeting:

    • Development of targeted delivery systems that preferentially deliver CXCR2 antagonists to specific cell populations (neutrophils versus endothelial cells)

    • This approach could selectively inhibit inflammatory neutrophil recruitment while preserving beneficial endothelial functions

  • Biased Ligand Development:

    • Engineering ligands that preferentially activate certain signaling pathways downstream of CXCR2 while avoiding others

    • This could potentially separate beneficial from detrimental CXCR2-mediated effects

  • Receptor Desensitization Modulation:

    • Targeting the receptor internalization and recycling machinery to modulate CXCR2 surface expression

    • This approach could provide temporal control over CXCR2 function in specific cells

  • Endothelial-Targeted Approaches:

    • Based on findings highlighting the critical role of endothelial CXCR2 in neutrophil recruitment and vascular permeability

    • These strategies would aim to modulate endothelial CXCR2 function specifically in disease contexts

How might advances in CXCR2 research translate to therapeutic applications?

Translation of CXCR2 research to therapeutics shows promise in several areas:

  • Acute Lung Injury and ARDS:

    • Targeting both leukocyte and endothelial CXCR2 could provide superior outcomes compared to traditional approaches

    • Insights from studies showing the role of endothelial CXCR2 in LPS-induced lung injury suggest dual-targeting approaches may be more effective

  • Cancer Angiogenesis:

    • CXCR2 antagonists could inhibit tumor-associated angiogenesis

    • Studies using corneal micropocket assays demonstrate that CXCR2 is essential for neovascularization induced by ELR+ CXC chemokines

  • Inflammatory Conditions:

    • CXCR2 antagonists could modulate neutrophil recruitment in conditions like inflammatory bowel disease, rheumatoid arthritis, and psoriasis

    • Understanding the distinct roles of CXCR2 on different cell types allows for more precise therapeutic targeting

  • Biomarker Development:

    • Quantitative assessment of CXCR2 ligands (using tools like ELISA) could serve as biomarkers for disease activity and treatment response

    • The precision and reliability of current quantitative assays make them suitable for clinical application

What are best practices for studying CXCR2 in primary rat endothelial cells?

When working with primary rat endothelial cells for CXCR2 research, follow these specialized approaches:

  • Cell Isolation and Culture:

    • Isolate primary microvascular endothelial cells from rat lung (RMVEC-L) or dermis (RMVEC-D)

    • Maintain cells in appropriate endothelial growth medium supplemented with endothelial growth factors

    • Validate endothelial phenotype using markers such as CD31, VE-cadherin, and von Willebrand factor

  • CXCR2 Expression Analysis:

    • Confirm CXCR2 expression using multiple methods:

      • RT-PCR for mRNA detection with appropriate controls

      • Western blot analysis using antibodies specific for rat CXCR2

      • Flow cytometry for surface expression quantification

    • Compare expression levels to known CXCR2-expressing cells (neutrophils) as positive controls

  • Functional Assessment:

    • Endothelial cell chemotaxis assays using modified Boyden chambers

    • Angiogenesis assays such as tube formation on Matrigel

    • Permeability assays measuring macromolecule passage across endothelial monolayers

    • Neutralizing antibody studies to confirm CXCR2 specificity of observed effects

  • Co-culture Systems:

    • Establish co-culture models with neutrophils to study cell-cell interactions

    • These systems more accurately reflect the complex in vivo environment and allow for investigation of bidirectional signaling

How can I optimize protocols for studying CXCR2-mediated signal transduction pathways?

To optimize protocols for studying CXCR2 signaling pathways in rat models:

  • Temporal Considerations:

    • Design time-course experiments to capture both rapid (seconds to minutes) and delayed (hours) signaling events

    • CXCR2 activation leads to receptor desensitization and internalization, which affects downstream signaling kinetics

  • Pathway-Specific Readouts:

    • G protein coupling: GTPγS binding assays

    • Calcium mobilization: Fluorescent calcium indicators (Fura-2, Fluo-4)

    • ERK/MAPK pathway: Phospho-specific antibodies in Western blotting

    • PI3K/Akt pathway: Phospho-Akt detection

    • Small GTPases (Rho, Rac): Pull-down assays for activated forms

  • Inhibitor Studies:

    • Use pathway-specific inhibitors to delineate signaling cascades

    • Include concentration gradient studies to distinguish specific from off-target effects

    • Complement with genetic approaches (siRNA, dominant-negative constructs) to validate findings

  • Cell Type Considerations:

    • Different cell types (neutrophils vs. endothelial cells) may utilize different signaling pathways downstream of CXCR2

    • Compare signaling mechanisms between cell types to identify both common and cell-specific pathways

What considerations are important when developing CXCR2 antagonists for use in rat models?

When developing CXCR2 antagonists for rat models, consider these critical factors:

  • Species Selectivity:

    • Test antagonist binding affinity for both rat and human CXCR2 to understand translational potential

    • Rat CXCR2 shares approximately 59% amino acid identity with human CXCR2, which may affect antagonist binding

    • Confirm antagonist specificity for CXCR2 versus related chemokine receptors like CXCR1

  • Pharmacokinetic Profiling:

    • Determine appropriate dosing regimens based on antagonist half-life in rats

    • Assess tissue distribution, particularly to target tissues such as lung

    • Evaluate brain penetration if central nervous system effects are of interest

  • Efficacy Validation:

    • Test antagonist effects on neutrophil migration in vitro

    • Validate in vivo efficacy using established models:

      • LPS-induced lung injury models

      • Corneal micropocket assays for angiogenesis inhibition

      • Compare results in wild-type rats to CXCR2-/- rats to confirm mechanism specificity

  • Control Experiments:

    • Include structurally related inactive compounds as negative controls

    • Test effects on CXCR2 surface expression to distinguish antagonism from receptor internalization

    • Evaluate potential off-target effects on related signaling pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.