Recombinant Rat C3a anaphylatoxin chemotactic receptor (C3ar1)

Shipped with Ice Packs
In Stock

Description

Introduction to C3a Anaphylatoxin Chemotactic Receptor (C3ar1)

The C3a anaphylatoxin chemotactic receptor (C3ar1) is a G protein-coupled receptor that plays a fundamental role in the complement system, an essential component of innate immunity . This receptor specifically binds to C3a, a complement-derived cationic inflammatory peptide capable of triggering anaphylactic reactions . As part of the complement cascade, C3ar1 mediates various inflammatory responses that contribute to host defense mechanisms.

C3ar1 belongs to the rhodopsin family of G protein-coupled receptors, characterized by seven transmembrane domains that span the cell membrane . Within the complement receptor classification, C3ar1 demonstrates distinctive structural and functional properties that differentiate it from other complement receptors such as C5ar1.

The rat C3ar1 has been successfully cloned and characterized, revealing significant homology with its human counterpart while maintaining species-specific variations . This conservation across species underscores the evolutionary importance of C3ar1 in mammalian immune function. The successful isolation of rat C3ar1 clone was confirmed through C3a binding analysis using stably transfected cells .

Northern blot analysis has demonstrated that rat C3ar1 is expressed in various tissues, with an expression pattern similar to human C3ar1 but notably different from rat C5ar1 . This differential expression suggests distinct functional roles for these complement receptors in rat physiology and immunological responses.

Recombinant Production and Characterization

The production of recombinant rat C3ar1 has been instrumental in advancing research on this important complement receptor. Recombinant protein technology allows for the controlled expression and purification of rat C3ar1 for detailed molecular and functional studies under standardized conditions.

Recombinant rat C3ar1 is typically produced using prokaryotic expression systems, with Escherichia coli being the predominant host organism . The expression process begins with the amplification of rat C3ar1 cDNA using polymerase chain reaction with specifically designed primers that capture the complete or partial coding sequence . The amplified gene is then inserted into appropriate expression vectors, transformed into bacterial cells, and induced to express the recombinant protein.

Following expression, the recombinant rat C3ar1 undergoes purification procedures to isolate the protein from bacterial cell components and contaminants. Commercially available recombinant rat C3ar1 products typically demonstrate a purity exceeding 85%, as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . This high level of purity ensures reliable experimental results when the recombinant protein is used in research applications.

Recombinant Rat C3ar1 Production Parameters

ParameterSpecification
Expression HostEscherichia coli
Purity>85% (SDS-PAGE)
Recommended ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Storage Additive5-50% glycerol (final concentration)
Shelf Life (Liquid Form)6 months at -20°C/-80°C
Shelf Life (Lyophilized Form)12 months at -20°C/-80°C
Short-term Storage4°C for up to one week

Proper storage and handling of recombinant rat C3ar1 are crucial for maintaining its stability and biological activity. The recombinant protein is available in both liquid and lyophilized forms, with each format having specific storage requirements . For reconstitution, manufacturers typically recommend using deionized sterile water to achieve a protein concentration of 0.1-1.0 mg/mL . The addition of glycerol at a final concentration of 5-50% is advisable for long-term storage to prevent protein degradation .

Repeated freezing and thawing should be avoided as these processes can compromise protein integrity and functional activity . For short-term applications, working aliquots of recombinant rat C3ar1 can be stored at 4°C for up to one week, although this approach should be limited to immediate experimental needs .

Functional Properties of Recombinant Rat C3ar1

Recombinant rat C3ar1 exhibits functional properties that closely resemble those of the native receptor, making it an invaluable tool for studying complement system functions. As a receptor for the anaphylatoxin C3a, it mediates various inflammatory reactions within the organism .

When C3a binds to the receptor, it triggers a conformational change that activates heterotrimeric G proteins . This activation initiates a cascade of intracellular signaling events that culminate in various cellular responses. The signaling pathway activated by rat C3ar1 demonstrates sensitivity to pertussis toxin, indicating the involvement of Gi/o class G proteins in signal transduction .

The primary cellular responses mediated by C3ar1 activation include chemotaxis (directed cell movement), granule enzyme release, and superoxide anion production . These processes are fundamental components of inflammatory responses and immune system function, highlighting the critical role of C3ar1 in host defense mechanisms against pathogens and tissue damage.

Functional Activities of Rat C3ar1

FunctionDescription
Ligand BindingBinds anaphylatoxin C3a and TLQP-21 peptide
Signaling PathwayG protein-coupled pathway (pertussis toxin-sensitive)
Cellular ResponsesChemotaxis, granule enzyme release, superoxide anion production
Expression RegulationDoes not increase significantly after LPS injection (unlike C5aR)
Novel InteractionsTarget receptor for VGF-derived peptide TLQP-21

A particularly significant recent discovery is the identification of rat C3ar1 as the target receptor for TLQP-21, a bioactive peptide derived from VGF (non-acronymic) . This finding substantially expands our understanding of C3ar1's functional repertoire beyond the traditional complement system, suggesting broader physiological implications. The binding of TLQP-21 to C3ar1 has been demonstrated to modulate cellular functions, including directing migration of certain cell types .

This novel interaction between TLQP-21 and C3ar1 establishes unexpected connections between complement signaling and metabolic regulation . Research with knockout mice has shown that C3ar1 deficiency can lead to transient resistance to diet-induced obesity and protection against high-fat diet-induced insulin resistance . These findings suggest previously unrecognized roles for C3ar1 in metabolic processes, highlighting the complex interplay between inflammation and metabolism.

Expression Pattern and Regulation

Rat C3ar1 demonstrates a distinctive expression pattern across various tissues with important implications for its physiological roles. Northern blot analysis has revealed that rat C3ar1 is expressed in multiple tissues, with a distribution pattern similar to that of human C3ar1 but notably different from rat C5ar1 .

Within the immune system, C3ar1 is expressed by numerous cell types including neutrophils, eosinophils, mast cells, monocytes, and dendritic cells . This broad distribution across immune cell populations underscores the receptor's importance in coordinating immune responses and inflammatory processes. Beyond the immune system, C3ar1 expression has been detected in tissues of the central nervous system, indicating potential roles in neuroimmune interactions .

A particularly noteworthy aspect of rat C3ar1 regulation is its response to inflammatory stimuli. Studies have demonstrated that unlike rat C5ar1, the expression of rat C3ar1 in various tissues does not increase significantly following lipopolysaccharide (LPS) injection . This observation suggests that the expression of C3ar1 and C5ar1 is independently regulated in rat cells and tissues, pointing to distinct regulatory mechanisms and potentially different functional roles during inflammatory responses.

The differential regulation of C3ar1 expression has significant implications for understanding its role in various physiological and pathological conditions. The constitutive expression of C3ar1 in certain tissues may indicate housekeeping functions beyond acute inflammatory responses, potentially including roles in tissue homeostasis, development, or other physiological processes.

Comparison of Rat C3ar1 and C5ar1 Expression

CharacteristicC3ar1C5ar1
Tissue DistributionMultiple tissuesMore limited distribution
Response to LPSNo significant increaseGreatly increased expression
Regulation MechanismConstitutive in many tissuesInducible in response to inflammatory stimuli
Expression in CNSPresentLess prominent

These distinct expression patterns and regulatory mechanisms highlight the specialized roles of different complement receptors in coordinating immune responses and maintaining tissue homeostasis. The independent regulation of C3ar1 and C5ar1 suggests that these receptors may serve complementary functions in different phases of inflammatory responses or in different tissue microenvironments.

Applications in Research and Drug Discovery

Recombinant rat C3a anaphylatoxin chemotactic receptor serves as a valuable research tool in multiple scientific disciplines. Its applications span from basic research into complement system function to drug discovery initiatives and investigations into various pathological conditions.

In fundamental research, recombinant rat C3ar1 provides a reliable reagent for studying ligand-receptor interactions within the complement system. Researchers utilize purified recombinant receptor for binding assays, enabling the characterization of natural and synthetic ligands with potential therapeutic applications. These studies contribute to our understanding of complement activation and regulation, processes crucial for innate immunity.

Drug discovery efforts have increasingly focused on complement receptors as potential therapeutic targets. Recombinant rat C3ar1 provides a platform for screening compound libraries, allowing researchers to identify molecules that can modulate receptor activity. Such compounds may form the basis for novel anti-inflammatory therapies targeting conditions associated with excessive complement activation.

The discovery that rat C3ar1 serves as a receptor for TLQP-21 has opened new avenues of research into metabolic regulation . This finding establishes a connection between the complement system and metabolic processes, suggesting that C3ar1-targeted interventions might offer therapeutic benefits in metabolic disorders such as obesity and diabetes.

Primers Used for Cloning Rat C3ar1

DirectionSequence
Forward Primer5′-CACCATGGAGTCTTTCACTGCTGACACC
Reverse Primer5′-CACATCCGTACTCATATGG

These molecular tools have facilitated the cloning and expression of rat C3ar1, enabling detailed structural and functional studies that advance our understanding of this important receptor . Similar approaches have been applied to C3ar1 from other species, including mouse, human, and hamster, allowing comparative studies that highlight species-specific variations in receptor structure and function.

Additionally, antibodies raised against recombinant rat C3ar1 serve as valuable tools for detecting and quantifying receptor expression in various experimental contexts. These antibodies enable immunohistochemical analyses, flow cytometry studies, and Western blot examinations of C3ar1 distribution and regulation in different tissues and cellular models.

Relationship to Human C3ar1 and Translational Implications

Understanding the similarities and differences between rat C3ar1 and its human counterpart is crucial for translating research findings from animal models to human applications. Comparative analyses reveal significant homology between rat and human C3ar1, with conserved structural elements and functional properties that reflect the evolutionary importance of this receptor in mammalian immunity.

The expression patterns of C3ar1 in various tissues show similarities between rat and human, distinguishing both from the more divergent expression patterns of C5ar1 . This conservation of expression patterns suggests similar physiological roles for C3ar1 across species, supporting the relevance of rat models for studying C3ar1-mediated processes in human health and disease.

Recent research has expanded our understanding of C3ar1 functions beyond traditional complement roles, implicating the receptor in processes such as metabolism, neurogenesis, and cancer progression . These emerging roles highlight the potential significance of C3ar1 as a therapeutic target in various human diseases, including metabolic disorders, neurodegenerative conditions, and malignancies.

The development of compounds targeting C3ar1 represents a promising approach for therapeutic intervention in complement-mediated disorders. Recombinant rat C3ar1 serves as a valuable tool in preclinical screening of such compounds, providing insights into their binding properties, efficacy, and potential off-target effects before advancing to human studies.

The translational value of research using recombinant rat C3ar1 is enhanced by the availability of comparative data across species. Molecular cloning approaches have facilitated the expression and characterization of C3ar1 from various species, including rat, mouse, human, and hamster . These resources enable systematic comparisons that inform the development of therapeutics with cross-species efficacy and improve the predictive value of preclinical models.

Technical Considerations and Experimental Applications

Working with recombinant rat C3a anaphylatoxin chemotactic receptor requires attention to various technical aspects to ensure optimal experimental outcomes. The storage, handling, and application of this protein demand specific protocols tailored to its biochemical properties.

Recombinant rat C3ar1 is typically available in either liquid or lyophilized form, with each format having distinct storage requirements. For liquid preparations, storage at -20°C or -80°C is recommended, with an expected shelf life of approximately 6 months . Lyophilized forms demonstrate greater stability, maintaining integrity for up to 12 months when stored at -20°C or -80°C .

Proper reconstitution procedures are essential when preparing recombinant rat C3ar1 for experimental use. Manufacturers typically recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol at a final concentration of 5-50% is advisable for long-term storage, with 50% being a common standard . Following reconstitution, it is crucial to avoid repeated freezing and thawing cycles, as these can compromise protein integrity and functional activity.

Experimental Applications of Recombinant Rat C3ar1

Multiple experimental approaches utilize recombinant rat C3ar1 to investigate various aspects of receptor function and complement system biology:

  1. Ligand binding assays measure the interaction between recombinant C3ar1 and its natural ligands (C3a) or synthetic analogs, providing insights into binding affinity, specificity, and potential antagonist development.

  2. Cell-based functional assays evaluate the biological activities mediated by C3ar1 activation, including calcium mobilization, chemotaxis, and enzyme release, offering a platform for screening potential therapeutic modulators.

  3. Structural studies, including crystallography and molecular modeling, utilize purified recombinant C3ar1 to elucidate the three-dimensional structure of the receptor, particularly in complex with its ligands.

  4. Antibody production against recombinant rat C3ar1 generates valuable tools for detecting and quantifying receptor expression in various experimental contexts, enabling immunohistochemical analyses and flow cytometry studies.

  5. Comparative studies across species examine differences and similarities between rat C3ar1 and its counterparts in other organisms, informing the translation of findings from animal models to human applications.

These diverse experimental applications highlight the versatility of recombinant rat C3ar1 as a research tool and underscore its importance in advancing our understanding of complement system biology and related physiological processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
C3ar1; C3a anaphylatoxin chemotactic receptor; C3AR; C3a-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MESFTADTNSTDLHSRPLFKPQDIASMVILSLTCLLGLPGNGLVLWVAGVKMKRTVNTVW FLHLTLADFLCCLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDR CLMVHKPIWCQNHRSVRTAFAVCGCVWVVTFVMCIPVFVYRDLLVVDDYSVCGYNFDSSR AYDYWDYMYNSHLPEINPPDNSTGHVDDRTAPSSSVPARDLWTATTALQSQTFHTSPEDP FSQDSASQQPHYGGKPPTVLIATIPGGFPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLY AHDFPDDYFDQLMYGNHAWTPQVAITISRLVVGFLVPFFIMITCYSLIVFRMRKTNLTKS RNKTLRVAVAVVTVFFVCWIPYHIVGILLVITDQESALREVVLPWDHMSIALASANSCFN PFLYALLGKDFRKKARQSVKGILEAAFSEELTHSTSCTQDKAPSKRNHMSTDV
Uniprot No.

Target Background

Function
The C3a anaphylatoxin chemotactic receptor (C3ar1) is a receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor plays a role in stimulating chemotaxis, granule enzyme release, and superoxide anion production.
Gene References Into Functions

Relevant Research Highlights

  1. C5aR and C5L2, but not C3aR, are expressed on CD11b-positive leukocytes in islet preparations. PMID: 22099750
  2. The C3 and C3a receptor system may be primarily involved in the pathogenesis of renal remodeling in hypertensive rats. PMID: 23713944
  3. The binding of TLQP-21 to C3AR1 not only has effects on signaling but also modulates cellular functions. PMID: 23940034
  4. Research provides the first evidence that C3aR and C5aR are both expressed in cerebellar granule cells during development and that C5a, but not C3a, is a potent inhibitor of apoptotic cell death in cultured granule neurons. PMID: 15292245
  5. The role of C3ar1 in the development of the rat cerebellum is reported. PMID: 18635264
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic function of rat C3ar1?

The rat C3a receptor (C3ar1) is a member of the G-protein-coupled receptor family characterized by seven transmembrane domains and a distinctively large second extracellular loop, which appears to be a unique structural feature of this receptor. The anaphylatoxin C3a, generated during complement activation, binds to C3ar1 to mediate various inflammatory reactions. The receptor functions primarily through G-protein-coupled signaling cascades that trigger intracellular calcium mobilization and subsequent cellular responses .

When designing experiments to study rat C3ar1, researchers should consider:

  • The receptor's conformational states, which affect ligand binding

  • The large extracellular loop's role in ligand recognition

  • The signal transduction pathways activated upon receptor stimulation

How does rat C3ar1 expression compare across different tissues?

Northern blot analysis of rat C3ar1 reveals expression in various tissues, similar to that of human C3ar1 but notably dissimilar to rat C5ar. The expression pattern suggests tissue-specific functions that may differ from other complement receptors. Importantly, research has shown that expression of rat C3ar1 in various tissues does not increase significantly after lipopolysaccharide (LPS) injection, whereas rat C5ar expression is greatly elevated under the same conditions .

This differential expression pattern suggests independent regulatory mechanisms for C3ar1 and C5ar, which should be considered when designing experiments targeting specific complement receptor functions in rat models.

How do C3ar1 knockout models help in understanding receptor function?

C3ar1 knockout models have been instrumental in elucidating the receptor's physiological and pathophysiological roles. Studies using C3ar1-deficient inbred strains of guinea pigs (C2BB/R−) with a mutation encoding a stop codon within the coding sequence of the C3ar have shown significantly decreased bronchial reactivity in ovalbumin (OVA)-induced asthma models compared to animals expressing wild-type C3ar1 .

Methodologically, researchers should:

  • Use appropriate control groups when working with knockout models

  • Consider potential compensatory mechanisms that may develop in knockout animals

  • Validate findings through multiple approaches, including pharmacological inhibition

How can researchers distinguish between C3ar1-dependent and independent effects of C3a in experimental systems?

This represents a methodological challenge as C3a can exert effects through both receptor-dependent and independent pathways, particularly in mast cells. To distinguish between these pathways, researchers should implement a multi-faceted approach:

  • Use selective C3ar1 antagonists like SB 290157 to block receptor-dependent effects

  • Compare responses in C3ar1 knockout cells/animals with wild-type counterparts

  • Employ receptor internalization assays to confirm receptor engagement

  • Analyze downstream signaling pathway activation specific to C3ar1 (e.g., calcium mobilization)

  • Consider cell-type specific differences in C3a responses (e.g., C3a induces degranulation in rat peritoneal mast cells via pathways that appear to be independent of cell surface C3ar1)

This approach is essential because studies have shown that C3a can induce degranulation in human mast cells through both C3ar1-dependent and independent mechanisms, while it doesn't induce degranulation in murine peritoneal mast cells or RBL-2H3 cells despite receptor expression .

What are the considerations for developing and using selective C3ar1 agonists and antagonists in rat models?

Development of selective C3ar1 modulators requires careful consideration of:

  • Receptor specificity: Compounds must be tested against related receptors (especially C5ar1) to confirm selectivity. For instance, SB 290157 demonstrated selectivity for C3ar1 by not antagonizing C5ar or six other chemotactic G protein-coupled receptors .

  • Metabolism stability: Native C3a degrades rapidly due to carboxypeptidase action to form C3a-desArg, which doesn't bind to C3ar1. Therefore, metabolically stable analogs are essential for in vivo studies .

  • Conformational considerations: C3ar1 modulators can induce different receptor conformations, leading to biased signaling. Recent research has demonstrated that the physiological ligands C3a and TLQP-21 may induce different downstream signaling pathways despite binding to the same receptor .

  • Species differences: Cross-reactivity between species should be evaluated, as compounds may have different affinities for human, rat, and mouse receptors. SB 290157, for example, inhibits C3a-induced calcium mobilization in cells expressing human, mouse, and guinea pig C3ar1 .

  • Validation methods: Proper validation includes binding assays, functional assays (calcium mobilization, receptor internalization), and confirmation in relevant in vivo models.

How does C3ar1 signaling interact with other inflammatory pathways in acute and chronic inflammation models?

C3ar1 signaling interacts with multiple inflammatory pathways, creating a complex network that requires sophisticated experimental approaches to unravel. Research indicates:

  • Temporal sequence of cellular responses: C3ar1 activation triggers a sequential immune response, beginning with mast cell degranulation (peak at 0.5h), followed by inflammatory macrophage infiltration, and later neutrophil activation (observed at 6h) during acute inflammation .

  • Immune cell recruitment and activation: C3ar1 expression correlates significantly with 14 types of immune cells. Positive correlations exist with T cells gamma delta, plasma cells, monocytes, macrophages M0, neutrophils, and resting mast cells, while negative correlations exist with B cells memory, macrophages M2, T cells CD4 memory resting, T cells CD8, T cells CD4 naive, B cells naive, dendritic cells resting, and NK cells resting .

  • Cross-talk with coagulation pathways: Gene Set Enrichment Analysis (GSEA) shows that C3ar1 is primarily enriched in coagulation and immunity pathways, suggesting an important role at the interface of these two systems .

To study these interactions effectively, researchers should:

  • Employ time-course experiments to capture the sequential nature of C3ar1-mediated responses

  • Use cell-specific knockout models to isolate the contribution of C3ar1 in different immune cell populations

  • Combine pharmacological and genetic approaches to validate findings

  • Consider tissue-specific effects of C3ar1 activation

What are optimal protocols for expressing and purifying recombinant rat C3ar1 for binding studies?

For successful expression and purification of recombinant rat C3ar1:

  • Expression system selection: Mammalian expression systems (e.g., HEK293, CHO cells) are preferred over bacterial systems for proper folding and post-translational modifications of GPCRs like C3ar1.

  • Construct design considerations:

    • Include an N-terminal signal sequence for proper membrane targeting

    • Add purification tags (His, FLAG) that don't interfere with ligand binding

    • Consider adding stabilizing mutations if needed for structural studies

  • Stable cell line development:

    • RBL-2H3 cells have been successfully used to express rat C3ar1 for binding studies

    • Select clones based on receptor expression levels and functional responses

  • Membrane preparation protocol:

    • Harvest cells at 80-90% confluence

    • Disrupt cells using nitrogen cavitation or mechanical homogenization

    • Isolate membrane fraction through differential centrifugation

    • Store membrane preparations at -80°C in small aliquots with protease inhibitors

  • Validation of functional expression:

    • Confirm receptor expression through Western blotting and flow cytometry

    • Verify functionality through calcium mobilization assays

    • Conduct radioligand binding assays using 125I-C3a

What methods are most effective for assessing C3ar1-mediated responses in different cell types?

Depending on the cell type and research question, different assays can be employed:

Calcium mobilization assays

  • Widely used to measure immediate C3ar1 activation

  • Load cells with calcium-sensitive dyes (Fluo-4, Fura-2)

  • Measure fluorescence changes upon ligand addition

  • Effective in various cell types including neutrophils and RBL-C3ar cells

  • IC50 values for antagonists like SB 290157 can be determined (e.g., 27.7 nM for RBL-C3ar cells, 28 nM for human neutrophils)

Receptor internalization assays

  • Flow cytometric approach using C3ar1-specific antibodies

  • Detects receptor disappearance from cell surface after activation

  • Provides functional readout of receptor engagement

  • Has been used successfully with human neutrophils

Mast cell degranulation assays

  • Measure release of granule contents (β-hexosaminidase, histamine)

  • Important to consider species differences (C3a induces degranulation in human but not mouse mast cells)

  • Can reveal receptor-independent effects of C3a

Label-free cellular response assays

  • xCELLigence platform measures impedance changes reflecting cellular responses

  • Provides real-time, quantitative measurement of global cellular responses

  • Useful for detecting off-target effects of compounds

In vivo inflammation models

  • Paw edema measurements in adjuvant-induced arthritis models

  • Airway neutrophilia quantification in LPS-induced models

  • Histological assessment of inflammatory cell infiltration

  • These models have been validated with C3ar1 antagonists like SB 290157

How can researchers accurately measure C3ar1 expression in tissue samples?

Multiple complementary approaches should be employed:

Quantitative RT-PCR

  • Design primers specific to rat C3ar1 to avoid cross-reactivity with related receptors

  • Use appropriate housekeeping genes for normalization

  • Include positive controls (tissues known to express C3ar1) and negative controls

Western blotting

  • Use validated antibodies specific to rat C3ar1

  • Include appropriate positive and negative controls

  • Quantify relative expression levels through densitometry

Immunohistochemistry/Immunofluorescence

  • Allows visualization of C3ar1 expression in specific cell types within tissues

  • Use antigen retrieval methods optimized for membrane proteins

  • Include isotype controls to confirm antibody specificity

Flow cytometry

  • Enables quantification of C3ar1 surface expression on specific cell populations

  • Use fluorochrome-conjugated antibodies against rat C3ar1

  • Include FMO (Fluorescence Minus One) controls

Single-cell RNA sequencing

  • Provides comprehensive view of C3ar1 expression across different cell types

  • Allows correlation with expression of other genes

  • Can reveal heterogeneity in expression within nominally similar cell populations

Research has shown that C3ar1 expression varies significantly between tissues and can be differentially regulated compared to other complement receptors like C5ar. Northern blot analysis has been effectively used to demonstrate these expression patterns .

How should researchers interpret contradictory findings on C3ar1 function across different species and disease models?

Species-specific and model-specific differences in C3ar1 function represent a significant challenge in data interpretation. To address contradictions effectively:

Consider inherent species differences

  • C3a induces degranulation in human mast cells but not in murine peritoneal mast cells or RBL-2H3 cells, despite receptor expression

  • In rat peritoneal mast cells, C3a causes degranulation through pathways potentially independent of cell surface C3ar1

Consider context-dependent roles

  • C3ar1 expression is downregulated in humans with metabolic dysfunction-associated steatotic liver disease compared to obese controls

  • C3ar1-deficient mice are more susceptible than wild-type mice to LPS challenge, implicating complement activation and C3ar1 in endotoxin-induced septic shock

Validate findings through multiple approaches

  • Combine genetic approaches (knockout models) with pharmacological interventions

  • Use both in vitro and in vivo systems to confirm observations

  • Employ multiple readouts of receptor function and inflammatory responses

What factors contribute to variability in C3ar1 experimental results?

Several factors can introduce variability in C3ar1 research:

Ligand quality and stability

  • Native C3a degrades rapidly to C3a-desArg, which doesn't bind to C3ar1

  • Commercial C3a preparations may vary in purity and activity

  • Storage conditions can affect ligand stability

Receptor expression levels

  • Varying expression levels between cell types and experimental conditions

  • Differential regulation under inflammatory conditions

  • Potential for receptor internalization affecting surface availability

Experimental readouts

  • Different assays measure distinct aspects of receptor function

  • Calcium mobilization assays capture immediate responses

  • Functional assays (degranulation, cytokine production) reflect downstream effects

Animal model variables

  • Genetic background effects in knockout models

  • Housing conditions affecting baseline inflammation

  • Age and sex differences in receptor expression and function

Technical considerations

  • Cell isolation techniques affecting cell activation status

  • Primary cell vs. cell line differences

  • Variability in tissue processing methods

To minimize variability, researchers should:

  • Standardize protocols across experiments

  • Include appropriate positive and negative controls

  • Report detailed methodological information

  • Consider blinding experimental groups during analysis

  • Use multiple readouts to confirm findings

How do different signaling pathways activated by C3ar1 contribute to distinct physiological outcomes?

C3ar1 activates multiple signaling pathways that can lead to distinct and sometimes opposing physiological outcomes:

G-protein-coupled signaling

  • Primary pathway involves Gαi protein activation

  • Leads to inhibition of adenylyl cyclase and decreased cAMP

  • Activates phospholipase C, leading to IP3 production and calcium mobilization

  • Results in rapid cellular responses like chemotaxis and degranulation

Biased agonism

  • Different ligands can preferentially activate distinct signaling pathways

  • The physiological ligands C3a and TLQP-21 may trigger different downstream responses despite binding to the same receptor

  • This concept is important when developing therapeutic agents targeting C3ar1

Temporal signaling dynamics

  • C3ar1 activation triggers a sequential immune response in inflammation

  • Initial mast cell degranulation (peak at 0.5h)

  • Followed by inflammatory macrophage infiltration

  • Later neutrophil activation (observed at 6h)

Cell type-specific responses

  • C3ar1 mediates different functions in various immune cells

  • In mast cells: degranulation and mediator release

  • In macrophages: cytokine production and polarization

  • In neutrophils: respiratory burst and delayed activation

Downstream pathway integration

  • C3ar1 signaling integrates with other inflammatory pathways

  • Cross-talk with coagulation cascade elements

  • Interaction with toll-like receptor signaling

  • Modulation of adaptive immune responses

To effectively study these complex signaling networks, researchers should:

  • Employ selective pathway inhibitors to dissect contributions

  • Use phospho-specific antibodies to track activation of specific pathways

  • Consider temporal dynamics in experimental design

  • Evaluate cell type-specific responses in mixed populations

How relevant are findings from rat C3ar1 studies to human disease mechanisms?

When translating findings from rat C3ar1 studies to human disease mechanisms, researchers should consider:

Receptor homology and structural conservation

  • Rat and human C3ar1 share significant sequence homology but have some structural differences

  • The large second extracellular loop, a defining feature of C3ar1, is present in both species

  • Some antagonists like SB 290157 inhibit both rat and human C3ar1

Pharmacological response conservation

  • Similar binding properties of antagonists across species

  • Comparable functional responses in cells expressing rat, mouse, and human C3ar1

  • SB 290157 functions as a competitive antagonist of C3a radioligand binding with an IC50 of 200 nM

Prognostic biomarker potential

  • C3AR1 expression has predictive value for sepsis outcomes in humans

  • The area under the ROC curve (AUC) of C3AR1 to discriminate between survival and non-survival groups was 0.800 in human sepsis patients

  • High C3AR1 expression group had significantly higher 28-day mortality than the low C3AR1 expression group

Table: Comparison of C3AR1 in Human Sepsis Patient Outcomes

CharacteristicLow expression of C3AR1High expression of C3AR1P-value
n3617-
ICU-acquired infection, n (%)0 (0%)2 (3.8%)0.099
Abdominal sepsis, n (%)5 (9.4%)17 (32.1%)<0.001
C3AR1 expression, mean ± SD7.1 ± 0.689.24 ± 0.59<0.001
Age, median (IQR)48 (33.25, 63.75)64 (56, 71)0.010
28-day mortalitySignificantly lowerSignificantly higher<0.05

What are the most promising therapeutic applications of C3ar1 modulators based on rat model studies?

Rat model studies have identified several promising therapeutic applications for C3ar1 modulators:

Allergic and inflammatory airway diseases

  • C3ar1 antagonist SB 290157 inhibits neutrophil recruitment in a guinea pig LPS-induced airway neutrophilia model

  • C3ar-deficient guinea pigs show decreased bronchial reactivity in OVA-induced asthma models

  • These findings suggest potential utility in asthma and acute respiratory distress syndrome

Inflammatory arthritis

  • SB 290157 (30 mg/kg i.p. b.i.d.) reduced paw swelling by 41% compared to control animals in a rat adjuvant-induced arthritis model

  • This suggests potential applications in rheumatoid arthritis and other inflammatory joint diseases

Acute neutrophil-driven traumatic pathologies

  • C3a agonism has been suggested as a potential treatment for acute neutrophil-driven traumatic pathologies

  • Carefully designed C3ar1 agonists with appropriate pharmacokinetic properties could have therapeutic potential

Sepsis and inflammatory shock

  • C3ar1's role in sepsis is complex, with potentially both protective and harmful effects

  • C3ar1 expression correlates with survival outcomes in human sepsis patients

  • This suggests the possibility of using C3ar1 as a prognostic biomarker and potential therapeutic target

Complement-related inflammatory disorders

For successful therapeutic development, researchers should consider:

  • Selectivity against related receptors, especially C5ar1

  • Metabolic stability to ensure sufficient exposure at target tissues

  • Pharmacokinetic and pharmacodynamic properties

  • Potential for unexpected effects due to biased agonism

  • Species differences that might affect translation to humans

What novel approaches are emerging for tissue-specific modulation of C3ar1 in research and therapy?

Several innovative approaches are being developed for tissue-specific targeting of C3ar1:

Cell-specific knockout models

  • Macrophage-specific C3ar1 knockout (C3ar1-MφKO) and Kupffer cell-specific C3ar1 knockout (C3ar1-KpKO) mouse models have been developed

  • These models allow precise evaluation of C3ar1 function in specific cell populations

  • Similar approaches can be applied to other cell types relevant to specific diseases

Biased ligand development

  • Design of ligands that preferentially activate beneficial signaling pathways while minimizing detrimental ones

  • Computational methods are being used to design novel C3ar1 ligands with specific signaling properties

  • This approach could reduce side effects while maintaining therapeutic efficacy

Nanoparticle-mediated delivery

  • Encapsulation of C3ar1 modulators in nanoparticles targeted to specific tissues

  • Can increase local concentration while minimizing systemic exposure

  • Particularly relevant for inflammatory conditions in specific organs

Temporal control of C3ar1 modulation

  • Given the temporal sequence of C3ar1-mediated inflammatory responses, timing of intervention is crucial

  • Development of drug delivery systems with controlled release profiles

  • Consideration of circadian rhythms in C3ar1 expression and function

Combination therapies

  • Co-targeting C3ar1 and related inflammatory pathways

  • Synergistic effects may allow lower doses and reduced side effects

  • Particularly relevant for complex inflammatory conditions with multiple mediators

Gene therapy approaches

  • CRISPR/Cas9-mediated modification of C3ar1 expression in specific tissues

  • Long-term modulation without repeated drug administration

  • Currently primarily a research tool but with therapeutic potential

These emerging approaches highlight the importance of understanding C3ar1 biology at a cellular and molecular level to develop precision-targeted interventions that maximize therapeutic benefits while minimizing unwanted effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.