Recombinant Rat C5a anaphylatoxin chemotactic receptor C5L2 (Gpr77)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Signaling Mechanisms

C5L2 interacts with complement anaphylatoxins and ASP, influencing inflammatory and metabolic processes. Key findings include:

Ligand Binding and Signaling

C5L2 binds C5a and C5adesArg with higher affinity than its counterpart C5aR1 (CD88) . Unlike C5aR1, which couples to Gαi proteins, C5L2 primarily signals via β-arrestin-2 and PI3K/Akt pathways . This divergence underpins its distinct regulatory roles:

  • Proinflammatory: Enhances cytokine release (e.g., TNF, CXCL10) and chemotaxis in mast cells .

  • Anti-inflammatory: Inhibits excessive IL-12 family cytokines and modulates macrophage responses .

Sepsis

In murine models of polymicrobial sepsis (cecal ligation and puncture), C5L2 deficiency improved survival, indicating its contribution to harmful inflammation . Both C5L2 and C5aR1 are required for G-CSF production during sepsis, highlighting their cooperative roles .

Renal Fibrosis

C5L2 exacerbates tubular injury but does not directly drive fibrosis accumulation. Its absence reduces tubular damage markers (e.g., KIM-1, NGAL) in unilateral ureteral obstruction models .

Mast Cell Activation

C5L2 mediates cytokine release (GM-CSF, CCL2) and adhesion via β-arrestin-2 and PI3K in human mast cells, independent of C5aR1 .

Functional Studies

Recombinant C5L2 is used in binding assays and signaling pathway analysis. For example:

  • β-Arrestin Recruitment: C5a-induced β-arrestin-2 activation in mast cells is blocked by C5L2 silencing .

  • PI3K/Akt Pathway: Inhibition of PI3K abolishes C5a-driven adhesion in mast cells .

Comparative Analysis with C5aR1

FeatureC5L2C5aR1
Ligand AffinityHigher for C5adesArg Stronger for C5a
Signaling Pathwaysβ-arrestin-2, PI3K/Akt Gαi, MAPK, Ca²⁺ mobilization
Role in SepsisProinflammatory Proinflammatory
Fibrosis ImpactReduces tubular injury Reduces fibrosis accumulation

Synergistic and Antagonistic Effects

  • Sepsis: C5L2 and C5aR1 act synergistically to worsen outcomes, but blocking either receptor improves survival .

  • Cytokine Regulation: C5a via C5L2 suppresses IL-12 family cytokines (IL-12, IL-23, IL-27) while upregulating IL-10 and G-CSF .

Species-Specific Variations

Rat C5L2 shares 86.4% identity with mouse C5L2 and 59.8% identity with human C5L2 . Structural differences, such as the absence of a DRY motif in the third intracellular loop, suggest reduced G-protein coupling in rodents compared to humans .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
C5ar2; C5l2; Gpr77; C5a anaphylatoxin chemotactic receptor 2; Complement component 5a receptor 2; G-protein coupled receptor 77
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLNDTTSKDYEYEYDQEQYSDLLNVPVDCPAGNCFSNDAYLIVLLGLYSVIFLVGVPGNT LLAWVTWKESRHRLGASWFLHLTMADLLCCVSLPFLAVPIAQKGHWPYGTAGCWLLSSIT VLSMYASVLLLTGLSGDLFLLAFRPSWKNADQRTCGVRVVQVSSWMLALLLTVPGAVYRK LLQEHYPPRLVCGTNYGGSVTAEVTITTVRFLFGFLVPLVFMASCHGILQRQMARRHWPL GTAVVVGFFICWTPFHLLRVIIAVASSHSPLLAWALEAEPLVTGLALAHSALNPIMFLYF GRKQLCKSLQAACHWALRDLQDEEESAVTKVSTSQEMVSEMPV
Uniprot No.

Target Background

Function
This protein functions as a receptor for the chemotactic and inflammatory C3a, C4a, and C5a anaphylatoxin peptides, as well as their dearginated forms, ASP/C3adesArg, C4adesArg, and C5adesArg, respectively. It weakly couples to G(i)-mediated signaling pathways.
Gene References Into Functions
  1. Following cecal ligation and puncture-induced sepsis in rats, neutrophils demonstrated a time-dependent decrease in C5L2. PMID: 15634936
  2. A C5aR isoform expressed by glia and neurons is regulated by NA and exerts anti-inflammatory functions. Alterations in C5aR isoform levels in diseased brain could contribute to the progression of inflammatory damage. PMID: 15715664
  3. Research findings provide the first evidence for a role of C5a receptor C5L2 in balancing the biological responses to Complement 5a PMID: 15784721
  4. C5L2 appears to bind complement factor C5a and its C-terminal cleavage product C5a des Arg through distinct mechanisms. Unlike C5a receptor (C5aR), C5L2 utilizes critical residues in its N-terminal domain to bind exclusively to C5a des Arg. PMID: 17158873
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of rat C5L2 and how does it differ from C5aR?

C5L2 (also known as GPR77) is a seven-transmembrane receptor that shares approximately 40% amino acid sequence identity with the C5a receptor (CD88). Unlike C5aR, C5L2 is structurally uncoupled from G proteins due to a critical amino acid substitution where leucine replaces arginine in the conserved DRY region at the terminus of the third intracellular transmembrane domain. This structural difference explains why, despite binding C5a, C5L2 does not induce classical signal transduction or trigger the biological responses typically associated with G protein-coupled receptor activation .

The structural differences between C5L2 and C5aR underlie their distinct functional roles, with C5aR mediating pro-inflammatory responses while C5L2 appears to serve as a regulatory receptor that modulates C5aR activity through decoy or scavenging mechanisms.

What ligands interact with C5L2 and with what relative affinities?

C5L2 exhibits a distinctive binding profile characterized by high affinity for both C5a and its metabolite C5adesArg. Additionally, it demonstrates lower affinity binding to C3a and C3adesArg . This binding profile differs from that of C5aR, which preferentially binds C5a with high affinity but has much lower affinity for C5adesArg.

The high affinity of C5L2 for C5adesArg is particularly significant because C5adesArg is the predominant form of C5a in circulation following complement activation, as carboxypeptidases rapidly convert C5a to C5adesArg. This suggests that C5L2 may play an important role in regulating the bioavailability of C5a and its metabolites during inflammatory responses.

What experimental evidence supports C5L2's role as a "decoy" or "scavenger" receptor?

The characterization of C5L2 as a scavenger receptor stems from multiple lines of evidence:

  • Functional studies showing that when C5L2 was transfected into various cell types, C5a binding to C5L2 failed to induce typical inflammatory responses such as chemotaxis, degranulation, or intracellular calcium mobilization .

  • The high binding affinity of C5L2 for both C5a and C5adesArg suggests it can effectively compete with C5aR for these ligands, thereby reducing their bioavailability for pro-inflammatory signaling .

  • Research demonstrating that C5L2 acts as a negative modulator of C5aR activity, supporting its role in attenuating excessive complement-mediated inflammation .

  • Observations that TLR-induced hypersensitivity to C5a can be mimicked by blocking C5L2, indicating that C5L2 normally constrains C5a-induced inflammatory responses .

These findings collectively support the hypothesis that C5L2 functions as a molecular sink that captures complement fragments to limit potential harmful effects of excessive complement activation.

How is C5L2 expression regulated during hepatic stellate cell (HSC) activation?

The regulation of C5L2 expression during hepatic stellate cell activation follows a complex pattern distinct from that of C5aR. Research has revealed that:

In quiescent HSCs, expression of both C5aR and C5L2 is relatively low. During HSC activation in culture, C5aR mRNA expression increases significantly in parallel with markers of HSC activation such as α-SMA and collagen 1A1 (Col1A1). Interestingly, C5L2 mRNA expression does not show the same upregulation pattern during this activation process .

In contrast, when examining HSCs activated in vivo through chronic carbon tetrachloride (CCl₄) exposure, both C5aR and C5L2 are expressed on the cell surface of activated, collagen-producing HSCs isolated from fibrotic livers .

This differential regulation between in vitro and in vivo conditions suggests that microenvironmental factors present in the fibrotic liver may influence C5L2 expression in ways not captured in isolated cell culture systems.

How do Toll-like receptor (TLR) activators affect C5L2 expression and function?

TLR activation has significant modulatory effects on C5L2 expression and function, which directly impacts cellular sensitivity to C5a. Key findings include:

  • Pre-exposure of PBMCs and whole blood to diverse TLR ligands or bacteria enhances C5a-induced pro-inflammatory responses .

  • TLR activation specifically targets C5L2 by reducing its activity, which consequently enhances cellular sensitivity to C5a-mediated inflammation .

  • TLR activation inhibits C5L2 expression upon C5a stimulation, providing a mechanism for the enhanced responsiveness to C5a .

  • This TLR-induced hypersensitivity to C5a can be experimentally reproduced by blocking C5L2, confirming C5L2's negative regulatory role .

  • The effect is not observed in C5L2 knockout mice, providing definitive evidence that C5L2 is the critical target of TLR-mediated enhancement of C5a responses .

These findings reveal a significant crosstalk mechanism within the innate immune system, where TLR activation amplifies complement-mediated inflammation by suppressing the inhibitory function of C5L2.

What are the recommended approaches for studying C5L2 function in primary rat cells?

When investigating C5L2 function in primary rat cells, several methodological approaches have proven effective:

Cell Isolation and Culture Techniques:
For studying C5L2 in hepatic stellate cells, isolation through density gradient centrifugation followed by culture on plastic for activation provides a reliable model. Researchers should monitor activation markers (α-SMA, Col1A1) in parallel with C5L2 expression to correlate functional changes with cell phenotype .

Expression Analysis:
A multi-faceted approach is recommended:

  • qRT-PCR for mRNA quantification, with careful primer design to ensure specificity for rat C5L2

  • Immunocytochemistry using validated antibodies for spatial distribution analysis

  • Flow cytometry for cell surface expression quantification, particularly useful for analysis of cells isolated from in vivo models

Functional Assays:

  • Migration assays (wound healing and Boyden chamber) to assess chemotactic responses

  • MCP-1 expression analysis to evaluate downstream mediators

  • Use of receptor antagonists to differentiate C5L2-specific effects from C5aR-mediated responses

In Vivo Validation:
Transgenic approaches, such as using mice expressing GFP under the collagen promoter combined with C5L2 knockouts, provide powerful tools for validating in vitro findings. This approach allows for isolation and characterization of specific cell populations from fibrotic tissue .

What are the key experimental challenges in distinguishing C5L2 from C5aR functions?

Researchers face several significant challenges when attempting to differentiate the specific functions of C5L2 from those of C5aR:

  • Shared Ligand Binding: Both receptors bind C5a, making it difficult to attribute responses solely to one receptor based on ligand application alone .

  • Differential Signaling Mechanisms: While C5aR signals through G-proteins, C5L2 signaling mechanisms remain less well-characterized, requiring different experimental approaches for detection .

  • Expression Correlation: The coordinated expression patterns of C5aR and C5L2 in many cell types complicates isolation of receptor-specific effects .

  • Methodological Limitations:

    • Antibody cross-reactivity between the structurally similar receptors

    • The need for sophisticated knockout or knockdown approaches

    • Challenges in developing truly selective pharmacological tools

  • Tissue-Specific Variations: The relative expression and functions of C5L2 compared to C5aR can vary significantly between different tissues and disease states .

To address these challenges, researchers should employ multiple complementary approaches, including:

  • Receptor-specific antagonists in parallel experiments

  • Gene silencing techniques (siRNA or CRISPR)

  • Cells isolated from receptor-specific knockout animals

  • Detailed dose-response studies to identify receptor-specific threshold effects

How does C5L2 contribute to liver fibrosis progression?

The role of C5L2 in liver fibrosis involves complex interactions with both pro-fibrotic and inflammatory pathways:

C5L2 is expressed on activated hepatic stellate cells (HSCs), which are the primary fibrogenic cell type in the liver . While C5L2 acts as a negative modulator of C5aR activity in many contexts, its specific contribution to fibrosis progression appears multifaceted.

Research indicates that complement activation, including the generation of C5a, is a dynamic process during carbon tetrachloride (CCl₄)-induced liver fibrosis . Although C5a does not directly enhance HSC activation markers (α-SMA, Col1A1), it significantly promotes HSC migration, a critical step in fibrogenesis .

C5L2 likely regulates this process by modulating the availability and activity of C5a. The observation that HSCs activated in vivo express both C5aR and C5L2 suggests that C5L2 may serve as a regulatory checkpoint that prevents excessive HSC recruitment and activation .

Additionally, C5a induces expression of MCP-1 (monocyte chemoattractant protein-1) in HSCs, which further enhances migration through CCR2 (MCP-1 receptor) signaling . This creates an amplification loop where complement activation promotes chemokine production, which in turn enhances cellular recruitment to sites of liver injury.

Understanding the precise role of C5L2 in this process could potentially identify new therapeutic targets for preventing or treating liver fibrosis.

What is the significance of C5L2 expression changes in sepsis?

C5L2 expression undergoes significant changes during sepsis that may have important prognostic and pathophysiological implications:

Clinical observations indicate that C5L2 expression on human neutrophils decreases in patients with sepsis . Importantly, this decrease in C5L2 expression appears to have prognostic value, as patients who survive sepsis tend to maintain higher levels of C5L2 compared to non-survivors .

The mechanistic explanation for this association likely involves the regulatory role of C5L2 in dampening excessive inflammatory responses. As a negative modulator of C5aR activity, adequate C5L2 expression may help prevent the "cytokine storm" and overwhelming systemic inflammation characteristic of severe sepsis .

The downregulation of C5L2 during sepsis may result from several processes:

  • Internalization following ligand binding during complement activation

  • Transcriptional suppression by inflammatory mediators

  • Proteolytic degradation in the inflammatory environment

  • TLR-mediated suppression of C5L2 expression, as TLR activation has been shown to inhibit C5L2 expression upon C5a stimulation

This last mechanism is particularly significant, as it creates a potential feed-forward loop: microbial components trigger TLR activation, which suppresses C5L2, thereby enhancing sensitivity to C5a and potentially exacerbating inflammatory damage.

The relationship between C5L2 expression and sepsis outcomes suggests that therapies aimed at maintaining or enhancing C5L2 expression or function might offer new approaches for sepsis management.

How might targeting C5L2 be utilized in developing anti-inflammatory therapies?

Targeting C5L2 presents several promising therapeutic strategies for modulating inflammatory responses:

  • C5L2 Stabilization/Enhancement Approaches:

    Since C5L2 functions as a negative regulator of C5aR-mediated inflammation, therapies aimed at enhancing its expression or stability could potentially dampen excessive inflammatory responses. This approach might be particularly valuable in conditions characterized by complement overactivation such as sepsis, where loss of C5L2 expression correlates with poor outcomes .

    Potential methods include:

    • Development of positive allosteric modulators that enhance C5L2's scavenging capacity

    • Gene therapy approaches to upregulate C5L2 expression

    • Inhibitors of pathways that downregulate C5L2 during inflammation

  • Targeted C5L2 Inhibition:

    In some contexts, selective inhibition of C5L2 might be beneficial. For instance, in conditions where enhanced innate immune responses are desirable (such as certain infections or immunodeficient states), blocking C5L2 could potentiate C5a-induced inflammatory responses and enhance pathogen clearance .

  • Dual C5aR/C5L2 Targeting:

    Simultaneously modulating both C5a receptors offers another strategic approach. Compounds that bias C5a signaling toward C5L2 and away from C5aR could potentially limit pro-inflammatory effects while preserving beneficial complement functions.

  • TLR/C5L2 Intersection Targeting:

    Given the documented crosstalk between TLR activation and C5L2 expression/function , therapies that specifically interrupt this interaction could provide precision tools for fine-tuning inflammatory responses in conditions where both pathways contribute to pathology.

The development of such therapeutic approaches requires further elucidation of C5L2's tissue-specific functions and a deeper understanding of its signaling mechanisms and regulation under various pathophysiological conditions.

What methodological approaches are most effective for studying the C5L2/C5aR balance in rat models of inflammation?

Investigating the C5L2/C5aR balance in rat models of inflammation requires sophisticated methodological approaches to capture the dynamic interplay between these receptors:

Genetic Manipulation Approaches:

  • Conditional knockout models allowing tissue-specific or inducible deletion of either receptor

  • Transgenic reporter systems (such as GFP under the control of the collagen promoter) to track activation of specific cell populations expressing these receptors

  • CRISPR/Cas9-mediated receptor modifications to study structure-function relationships

Pharmacological Tools:

  • Selective receptor antagonists administered at varying time points during the inflammatory response

  • Biased ligands that preferentially activate one receptor over the other

  • CCR2 antagonists (such as compound 227016) to evaluate the contribution of downstream chemokine signaling to receptor-mediated effects

Advanced Imaging Techniques:

  • Intravital microscopy to visualize receptor expression and cellular recruitment in real-time

  • Fluorescence resonance energy transfer (FRET) to assess receptor proximity and potential interactions

  • Positron emission tomography (PET) using radiolabeled ligands to track receptor distribution in vivo

Ex Vivo Analysis:

  • Flow cytometric analysis of receptor expression on cells isolated from inflamed tissues

  • Ex vivo stimulation assays using blood or isolated cells from treated animals to assess functional responses

  • Single-cell RNA sequencing to capture heterogeneity in receptor expression across cell populations

Experimental Models:

  • Liver fibrosis models induced by carbon tetrachloride are particularly useful for studying C5L2/C5aR dynamics in hepatic stellate cells

  • Sepsis models (cecal ligation and puncture) to examine neutrophil receptor expression and correlation with outcomes

  • Models combining TLR activation with complement stimulation to investigate receptor crosstalk

Applying these complementary approaches allows researchers to build a comprehensive picture of how the C5L2/C5aR balance influences inflammatory progression and resolution in different physiological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.