Recombinant Rat CAAX prenyl protease 2 (Rce1)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Biological Role

Recombinant Rat Rce1 is a 329-amino-acid integral membrane protease expressed in heterologous systems (e.g., E. coli or mammalian cells) with a polyhistidine (His) tag for purification . Its primary function involves endoproteolytic processing of farnesylated or geranylgeranylated CAAX proteins, a step essential for the membrane association of signaling molecules like Ras and Rho GTPases . Unlike geranylgeranylated proteins, farnesylated substrates such as Ras require Rce1-mediated cleavage for correct plasma membrane targeting .

Expression Systems

  • Bacterial (E. coli): Yields full-length protein (1–329 aa) with >90% purity, lyophilized in Tris/PBS buffer .

  • Mammalian cells: Produces soluble protein with higher post-translational fidelity, provided in liquid or lyophilized form .

Substrate Specificity

  • Farnesylated substrates: Human RhoA, Ras isoforms (H-, K-, N-Ras) .

  • Geranylgeranylated substrates: Not processed by Methanococcus maripaludis Rce1 homologs but cleaved by eukaryotic variants .

Key Findings

  • Localization defects: Rce1 knockout in mouse embryonic fibroblasts (MEFs) mislocalizes farnesylated Ras to cytosol, impairing oncogenic signaling .

  • Photoreceptor survival: Retinal Rce1 deficiency disrupts trafficking of phosphodiesterase 6 (PDE6), leading to photoreceptor degeneration .

  • Actin remodeling: Geranylgeranylated Rho GTPases (Rac1, Cdc42) remain functional in Rce1⁻/⁻ cells, highlighting lipid-specific processing requirements .

Applications in Disease Research

  • Cancer therapeutics: Rce1 inhibition disrupts Ras membrane localization, reducing tumor growth in preclinical models .

  • Neurodegeneration: Impaired PDE6 trafficking in Rce1-deficient retinas models retinal dystrophy mechanisms .

  • Plant biology: Arabidopsis Rce1 homologs restore plasma membrane localization of ROP GTPases in yeast, confirming evolutionary conservation .

Mechanistic and Inhibitor Studies

Rce1 employs a glutamate-activated water molecule for proteolysis, distinct from aspartyl or metalloprotease mechanisms . Inhibitors like N-acetyl-S-farnesyl-L-cysteine (AFC) block activity by competing with prenylated substrates . Structural data reveal a potential drug-binding site at the TM2–TM4 interface, critical for lipid anchoring .

Challenges and Future Directions

  • Isoform complexity: Mammals express two Rce1 splice variants (Iso1/Iso2) with differential regulation by deubiquitinases like USP17 .

  • Therapeutic targeting: Developing isoform-specific inhibitors remains challenging due to Rce1’s membrane-embedded architecture .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rce1; CAAX prenyl protease 2; Farnesylated proteins-converting enzyme 2; FACE-2; Prenyl protein-specific endoprotease 2; RCE1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Rce1
Target Protein Sequence
MAALGGDGLRLLSVSRPERQPESAALSSPGPGLCCWVSVFSCFSLACSYVGSLYVWKSEL PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL LLTMILFLGPLMQLCMDCPCDLTDGLKVVLAPRSWARRLTDMRWLRNQVIAPLTEELVFR ACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFLSAGHLIGPVLCH SFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCMLLERTG ASETLLCS
Uniprot No.

Target Background

Function
This enzyme proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. It has demonstrated the ability to process K-Ras, N-Ras, H-Ras, RAP1B, and G-gamma-1.
Database Links

KEGG: rno:309153

UniGene: Rn.105170

Protein Families
Peptidase U48 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.