Recombinant Rat Calcitonin gene-related peptide type 1 receptor (Calcrl)

Shipped with Ice Packs
In Stock

Description

Functional Role and Signaling Mechanisms

Calcrl functions as a G protein-coupled receptor (GPCR) requiring interaction with Receptor Activity-Modifying Proteins (RAMPs) for ligand specificity :

  • With RAMP1: Forms the canonical CGRP receptor (CGRPR), activating Gαs-mediated cAMP production .

  • With RAMP2/3: Creates adrenomedullin (AM) receptors (AM1/AM2), linked to calcium signaling and nitric oxide release .

Key signaling pathways:

  1. cAMP-PKA Pathway: Primary route for vasodilation and anti-inflammatory effects .

  2. ERK1/2 Phosphorylation: Mediates cell proliferation in endothelial and smooth muscle cells .

  3. Calcium-NO Signaling: AM2 preferentially activates this pathway, distinct from CGRP/AM1 .

3.1. Agonist Bias and Physiological Relevance

Studies using recombinant Calcrl revealed endogenous agonist bias:

  • CGRP: Potent cAMP activation (EC50 = 0.1–1 nM) and pro-proliferative effects .

  • AM2: Biased toward calcium signaling (EC50 = 10 nM), enhancing nitric oxide production .

This bias explains tissue-specific responses despite receptor sharing .

3.2. Disease Models and Therapeutic Targeting

  • Migraine: CGRPR antagonists (e.g., telcagepant) show nanomolar affinity (Ki = 0.77 nM) .

  • Inflammation: Upregulation of Calcrl and RAMP1/2 in rat nucleus accumbens during inflammation suggests pain modulation roles .

  • Cardiovascular Diseases: AM1 receptor activation reduces pulmonary hypertension via vasodilation .

Comparative Species Analysis

Rat Calcrl shares 89% sequence identity with human and mouse orthologs . Critical differences include:

  • Ligand Binding Pocket: Rat-specific residues (e.g., Tyr²⁷⁴) enhance CGRP affinity .

  • RAMP Interactions: Rat RAMP1 stabilizes Calcrl more effectively than human RAMP1 in vitro .

Quality Control and Validation

Recombinant Calcrl is validated via:

  • Functional Assays: cAMP production in transfected HEK293 cells (EC50 ≤ 1 nM for CGRP) .

  • Binding Studies: Competitive inhibition with ¹²⁵I-CGRP (IC50 = 2.2 nM in human cells) .

  • Immunoblotting: Anti-His tag antibodies confirm protein integrity .

Challenges and Future Directions

  • Receptor Trafficking: AMY1 receptors show minimal internalization compared to CGRPR, affecting drug duration .

  • Species-Specific Responses: Rat Calcrl exhibits higher basal activity than human orthologs in vitro .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Calcrl; Cgrpr; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-464
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
ESEEGANQTDLGVTRNKIMTAQYECYQKIMQDPIQQGEGLYCNRTWDGWLCWNDVAAGTE SMQYCPDYFQDFDPSEKVTKICDQDGNWFRHPDSNRTWTNYTLCNNSTHEKVKTALNLFY LTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLFFSFVCNSIVTIIHLTAVANNQA LVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFP LLPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVT HQAESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVAEEVYDYVMHILMHYQGLLVSTI FCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASYTVSTISDVQGYSHDCPTEHLNG KSIQDIENVALKPEKMYDLVM
Uniprot No.

Target Background

Function
This receptor, in conjunction with RAMP1, acts as a receptor for calcitonin-gene-related peptide (CGRP); and with RAMP2 or RAMP3, as a receptor for adrenomedullin. Its activity is G protein-mediated, stimulating adenylyl cyclase.
Gene References Into Functions
  1. Endosomal signaling of the CLR mediates pain transmission. PMID: 29087309
  2. Lung ischemia-reperfusion injury rapidly upregulates TRPV1 in the lungs and CRLR and NK1R in the rat brainstem. PMID: 27338549
  3. Hypercholesterolemia in rats shows increased expression of IMD and its receptor components (CRLR, RAMP1, RAMP2, and RAMP3) within the aorta. PMID: 26927337
  4. Morphine treatment differentially regulates CRLR and RAMP1 expression in primary neuronal cultures, suggesting involvement of the CGRP receptor in morphine-related functions. PMID: 23570731
  5. CLR immunoreactivity is observed in satellite glial cells (SGCs) and nerve fibers, but not neurons. PMID: 22208649
  6. CGRP/CGRP receptor signaling plays a role in a rat model of synovitis, suggesting that blocking this signaling pathway could offer targeted therapy for synovitis in rheumatoid arthritis or osteoarthritis. PMID: 22233274
  7. Abundant expression of CGRP and its receptor elements CLR and RAMP1 in the cerebellum suggests a functional role of CGRP in cerebellar Purkinje cells. PMID: 21040789
  8. CALCRL protein is found in neuromuscular junctions, with a 6-fold elevation of Calcrl mRNA levels at the muscle endplate. Two distinct, alternatively spliced Calcrl transcripts generate a single translation product. PMID: 21111722
  9. The spatiotemporal pattern of ADM peptide concentration in the rat female reproductive system during gestation suggests an important role for ADM in gestation. PMID: 21034462
  10. Coexpression of CRLR and RAMP2 or RAMP3 mediates the inhibitory effect of adrenomedullin on cell migration, independent of cAMP-dependent signaling pathways. PMID: 12538603
  11. Significantly higher mRNA expression of receptor components is observed in pregnant compared to nonpregnant rats. PMID: 12801991
  12. Immunohistochemical and western blot analyses demonstrate high levels of calcitonin receptor-like (CRL) receptor expression in rat microvascular endothelium. PMID: 14642779
  13. CRLR is present in the nucleus accumbens of intact rats and is significantly upregulated in rats with inflammation. PMID: 15193773
  14. Adrenomedullin and its receptor component (CRLR/RAMP2) mRNAs are concomitantly expressed in various adipose tissues, with tissue-specific upregulation during obesity development. PMID: 15315911
  15. CRLR and RAMP1, components of the CGRP receptor, are significantly upregulated in mesenteric arteries in an Ang II model. PMID: 15643132
  16. Intracardiac adrenomedullin and calcitonin receptor-like receptor/receptor activity-modifying proteins (RAMP2 and RAMP3) complexes are upregulated in volume overload-induced cardiac hypertrophy. PMID: 15680493
  17. CLR and RAMP1 traffic from endosomes to lysosomes via ubiquitin-independent mechanisms, undergoing degradation at different rates. PMID: 17310067
  18. In trinitrobenzene sulfonic acid-induced colitis, CLR knockdown rats show greater edema and necrosis than controls, demonstrating CLR's function as a CGRP receptor. PMID: 17363466
  19. CGRP or adrenomedullin receptors modulate opioid release in the dorsal horn. PMID: 17614212
  20. CGRP induces more pronounced and prolonged tachycardia in calcitonin receptor-like receptor transgenic mice by stimulating myocardial sympathetic activity. PMID: 17660394
  21. A proposed mechanism involves endosomal ECE-1 degrading neuropeptides in endosomes to disrupt the peptide/receptor/beta-arrestin complex, promoting receptor recycling and resensitization. PMID: 18039931
  22. Effects of immobilization on tendon healing are linked to changes in the peripheral expression of substance P (NK(1))- and calcitonin gene-related peptide (CRLR and RAMP-1)- receptors. PMID: 18655130
  23. CRLR mRNA and protein levels are upregulated in spontaneously hypertensive rats. PMID: 19041918
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Calcrl and how does it function in signaling pathways?

Calcrl is a G protein-coupled receptor (GPCR) related to the calcitonin receptor family. Its functionality depends critically on association with single transmembrane domain receptor activity-modifying proteins (RAMPs). The specificity of receptor formation varies based on RAMP interaction:

  • When associated with RAMP1: forms a CGRP receptor

  • When associated with RAMP2: forms an adrenomedullin (AM) receptor (AM1)

  • When associated with RAMP3: forms a dual CGRP/AM receptor (AM2)

These Calcrl-containing receptors primarily couple to the G protein Gs, which activates adenylate cyclase, resulting in intracellular cyclic adenosine monophosphate (cAMP) generation. This signaling pathway initiates a cascade of cellular responses that mediate Calcrl's physiological effects . The receptor is a heterodimer composed of two polypeptide chains with differing amino acid compositions and features multiple hydrophobic and hydrophilic regions throughout its structure .

What physiological systems are regulated by rat Calcrl and what are its primary ligands?

Rat Calcrl regulates multiple physiological systems through its interaction with two primary ligands:

  • Calcitonin Gene-Related Peptide (CGRP): The principal neuropeptide activating Calcrl when paired with RAMP1

  • Adrenomedullin (ADM): Activates Calcrl when paired with RAMP2 or RAMP3

Calcrl-containing receptors are distributed throughout the body, suggesting regulatory roles in:

  • Cardiovascular system: Blood flow regulation and vascular tone

  • Immune system: Inflammatory response modulation

  • Nervous system: Pain signaling and neurogenic inflammation

  • Respiratory system: Airway function

  • Gastrointestinal system: Motility and secretion

  • Endocrine system: Hormone regulation

The widespread distribution of Calcrl explains its involvement in various pathological conditions including migraine, cardiovascular disorders, and inflammatory diseases .

What are the most effective methods for measuring Calcrl expression and activity in rat tissue samples?

For accurate measurement of rat Calcrl expression and activity, researchers should consider multiple complementary approaches:

For protein detection and quantification:

  • Sandwich ELISA assays: Highly sensitive (<0.094ng/ml) with a detection range of 0.156-10ng/ml for rat Calcrl in serum, plasma, tissue homogenates, and cell culture supernatants

  • Western blotting: For semi-quantitative detection with appropriate antibodies

  • Immunohistochemistry: For spatial localization within tissues

For functional activity assessment:

  • cAMP accumulation assays: Measures the primary second messenger activated by Calcrl

  • Calcium flux assays: Detects changes in intracellular calcium levels upon receptor activation

  • HTRF (Homogeneous Time-Resolved Fluorescence): Provides high-throughput compatibility for screening studies

When selecting a detection method, researchers should consider specific experimental requirements, including sensitivity needs, sample type, and whether spatial information is necessary. For maximum reliability, combining protein expression measurement with functional activity assessment is recommended.

How can researchers validate the specificity of antibodies for rat Calcrl detection?

Antibody validation is critical for accurate Calcrl detection. A comprehensive validation protocol should include:

  • Positive and negative controls:

    • Recombinant rat Calcrl-expressing cells vs. non-expressing controls

    • Tissue samples with known Calcrl expression patterns

    • Competitive binding assays with purified Calcrl protein

  • Cross-reactivity assessment:

    • Testing against related receptors (especially calcitonin receptor)

    • Verification in Calcrl knockout or knockdown models

    • Western blot analysis to confirm detection of appropriate molecular weight band

  • Functional validation:

    • Correlation of antibody binding with functional receptor assays

    • Co-localization studies with known Calcrl-interacting proteins (RAMPs)

    • Testing antibody effects on receptor signaling (blocking vs. non-blocking)

  • Reproducibility testing:

    • Validation across multiple experimental conditions and sample types

    • Testing of lot-to-lot variability for commercial antibodies

Careful validation enhances research reliability and prevents false interpretations arising from non-specific antibody interactions.

What are the key considerations when designing experiments to manipulate Calcrl expression or activity in rat models?

When designing experiments to manipulate Calcrl expression or activity, researchers should consider:

Genetic manipulation approaches:

  • Conditional knockout models: Preferable to total knockout which may affect development

  • CRISPR/Cas9 gene editing: For precise modifications of Calcrl sequence

  • RNAi-based knockdown: For transient reduction in different tissues

  • Overexpression systems: For gain-of-function studies using viral vectors

Pharmacological approaches:

  • Receptor antagonists: Consider specificity for Calcrl vs. related receptors

  • Peptide mimetics: May offer enhanced stability compared to natural ligands

  • Small molecule modulators: For potential therapeutic applications

  • Antibody-based interventions: For receptor blocking or downstream signaling inhibition

Experimental controls:

  • RAMP manipulation: Since functional receptor requires both Calcrl and RAMPs

  • Ligand-specific controls: Different responses may occur with CGRP vs. adrenomedullin

  • Tissue-specific considerations: Expression patterns and receptor coupling may vary across tissues

Timepoint selection:

  • Acute vs. chronic manipulation: Different physiological adaptations may occur

  • Developmental timing: Receptor expression and function may change during development

  • Disease progression correlation: Align intervention with relevant disease stages in models

A well-designed experiment will include appropriate controls for both receptor specificity and systemic effects of manipulation techniques.

How should researchers account for Calcrl-RAMP interactions when studying receptor function?

The functional diversity of Calcrl depends entirely on its association with different RAMPs, making these interactions critical considerations in experimental design:

  • Expression verification strategy:

    • Always verify both Calcrl and relevant RAMP expression in the experimental system

    • Use co-immunoprecipitation to confirm actual association between Calcrl and specific RAMPs

    • Consider that receptor pharmacology will vary based on which RAMP is co-expressed

  • Manipulation approach:

    • Design genetic manipulations that target specific Calcrl-RAMP combinations rather than Calcrl alone

    • Consider using bicistronic expression systems to ensure proper stoichiometry of receptor components

    • Validate that interventions specifically affect the intended receptor complex

  • Functional characterization:

    • Test responses to multiple ligands (CGRP and adrenomedullin) to identify receptor phenotype

    • Employ pharmacological agents with known selectivity for specific Calcrl-RAMP combinations

    • Measure multiple signaling outputs as different RAMP associations may bias toward different pathways

  • Interpretation considerations:

    • Correlate observations with RAMP expression in relevant tissues

    • Account for potential compensatory changes in other RAMPs when one is manipulated

    • Consider the possibility of heterogeneous receptor populations in complex tissues

Failure to account for RAMP interactions may lead to contradictory results or misinterpretation of Calcrl function in experimental systems.

How can researchers effectively use rat Calcrl as a model for studying CGRP receptor function in migraine pathophysiology?

Rat Calcrl models offer valuable insights into migraine pathophysiology through several research approaches:

Experimental model development:

  • Trigeminal ganglion culture systems expressing rat Calcrl + RAMP1

  • Dural inflammatory models with CGRP challenge

  • Behavioral models correlating Calcrl activity with pain responses

  • Transgenic models with human CALCRL substitution for translational studies

Key investigation parameters:

  • Receptor sensitization mechanisms under inflammatory conditions

  • CGRP-induced neurogenic inflammation via Calcrl activation

  • Vascular responses mediated by Calcrl in meningeal vasculature

  • Electrophysiological changes in trigeminal neurons following receptor activation

Translational approaches:

  • Correlate findings with clinical observations from human migraine patients

  • Test potential therapeutic agents targeting the Calcrl-CGRP axis

  • Explore combination therapies affecting multiple aspects of the migraine pathway

Research has demonstrated that receptor responsiveness to CGRP can be significantly enhanced both in vitro and in vivo, suggesting mechanisms by which sensitization of Calcrl might contribute to migraine susceptibility . When designing such studies, researchers should carefully consider anatomical differences between rat and human trigeminal systems while leveraging the conserved molecular mechanisms of Calcrl function.

What role does Calcrl play in cancer biology and how can researchers investigate this connection?

Recent evidence points to important roles for Calcrl in cancer biology, particularly in hematological malignancies such as acute myeloid leukemia (AML). Researchers can investigate these connections through several approaches:

Expression analysis approaches:

  • Quantify Calcrl expression in primary rat cancer models and correlate with disease progression

  • Compare expression in stem-like cancer cell populations versus bulk tumor cells

  • Analyze co-expression patterns with RAMPs in different cancer subtypes

Functional investigation methods:

  • Knockdown or knockout studies in cancer cell lines to assess effects on:

    • Proliferation and cell cycle progression

    • Colony formation capacity

    • Drug resistance profiles

    • Stem cell signature maintenance

Translational relevance:
In human AML, CALCRL expression has been identified as an independent prognostic factor. High CALCRL expression correlates with:

These associations remain significant even after adjusting for established risk factors like age, white blood cell count, and genetic risk classification, suggesting CALCRL is a master regulator of relapse-initiating, drug-tolerant AML cells .

Researchers using rat models should design experiments that investigate whether similar mechanisms operate in rodent cancer models, potentially offering insights into therapeutic targeting strategies.

How do researchers resolve contradictory findings in Calcrl signaling studies between in vitro and in vivo models?

Resolving contradictions between in vitro and in vivo Calcrl signaling findings requires systematic troubleshooting:

Common sources of discrepancies:

  • Receptor complex heterogeneity: Different RAMP associations may predominate in different models

  • Signal transduction differences: Cell lines may express different G-protein subtypes or effector molecules

  • Ligand accessibility: Pharmacokinetics and tissue barriers affect ligand availability in vivo

  • Compensatory mechanisms: In vivo systems may activate alternative pathways absent in vitro

Resolution methodology:

  • Comprehensive characterization:

    • Profile complete receptor complex components in both systems

    • Compare signaling pathway activation patterns beyond primary pathways

    • Analyze temporal dynamics of receptor activation and desensitization

  • Bridging experimental approaches:

    • Develop ex vivo systems that preserve tissue architecture but allow controlled manipulation

    • Use tissue-specific conditional manipulation in vivo to mirror in vitro conditions

    • Employ in vitro co-culture systems that better represent in vivo cellular interactions

  • Advanced analytical techniques:

    • Single-cell analysis to detect subpopulation responses masked in bulk measurements

    • Intravital imaging to directly observe receptor function in intact systems

    • Computational modeling to reconcile seemingly contradictory datasets

  • Translational validation:

    • Confirm key findings in multiple model systems

    • Correlate with human tissue analyses when possible

    • Focus on conserved mechanisms with therapeutic relevance

By systematically addressing these factors, researchers can develop more nuanced understanding of context-dependent Calcrl signaling mechanisms.

What evidence supports Calcrl as a therapeutic target, and how can researchers evaluate its potential in preclinical models?

Substantial evidence supports Calcrl as a therapeutic target across multiple disease areas:

Evidence by disease area:

  • Migraine: CGRP receptor antagonists targeting Calcrl-RAMP1 have demonstrated clinical efficacy

  • Cancer: High CALCRL expression correlates with worse outcomes in AML, and knockout reduces colony formation in human AML cell lines

  • Inflammatory conditions: Calcrl signaling modulates multiple inflammatory processes

  • Cardiovascular disorders: Calcrl-mediated signaling affects vascular tone and remodeling

Preclinical evaluation approaches:

  • Target validation:

    • Genetic manipulation studies (conditional knockout, RNAi) in disease models

    • Pharmacological proof-of-concept using available tool compounds

    • Expression correlation with disease progression metrics

  • Compound screening:

    • Development of high-throughput functional assays using rat Calcrl cell lines

    • Structure-based drug design leveraging receptor structural information

    • Phenotypic screening in disease-relevant cell systems

  • Efficacy assessment:

    • Disease-specific endpoints in appropriate rat models

    • Biomarker development for target engagement confirmation

    • Combination studies with standard-of-care treatments

  • Safety evaluation:

    • Assessment of on-target effects in tissues with physiological Calcrl function

    • Careful monitoring of cardiovascular parameters given vascular expression

    • Developmental toxicity studies due to role in multiple physiological systems

For AML specifically, researchers should consider designing therapeutic strategies targeting relapse-initiating, drug-tolerant cell populations that express high levels of Calcrl, as these appear to be master regulators of disease recurrence .

What are the methodological challenges in developing small molecule modulators of rat Calcrl, and how can they be addressed?

Developing small molecule modulators of rat Calcrl presents several significant challenges:

Key challenges and solutions:

  • Receptor complex heterogeneity:

    • Challenge: Calcrl functions as part of heteromeric complexes with different RAMPs

    • Solution: Develop screening systems with defined RAMP-Calcrl combinations to identify complex-specific modulators

    • Approach: Bicistronic expression systems ensuring consistent stoichiometry of components

  • Large peptide binding interface:

    • Challenge: Natural ligands (CGRP, adrenomedullin) are peptides with extensive receptor contacts

    • Solution: Focus on allosteric modulators or key interaction hotspots rather than direct competitive inhibition

    • Approach: Fragment-based screening combined with structural biology insights

  • Selectivity and specificity:

    • Challenge: Close structural similarity to related receptors (especially calcitonin receptor)

    • Solution: Leverage subtle structural differences between receptor subtypes

    • Approach: Structure-activity relationship studies with focused medicinal chemistry optimization

  • Translational relevance:

    • Challenge: Species differences between rat and human Calcrl

    • Solution: Develop parallel assays in rat and human receptor systems

    • Approach: Create humanized rat models for advanced preclinical testing

  • Complex pharmacology:

    • Challenge: Biased signaling through different pathways depending on ligand and RAMP

    • Solution: Develop pathway-specific assays to identify biased modulators

    • Approach: Multiplexed signaling readouts to comprehensively characterize compound effects

By systematically addressing these challenges through integrated approaches combining structural biology, molecular pharmacology, and medicinal chemistry, researchers can develop effective small molecule modulators of rat Calcrl with potential translational applications.

How should researchers interpret changes in Calcrl expression across different experimental conditions and disease models?

Interpreting changes in Calcrl expression requires careful consideration of multiple factors:

Analytical framework:

  • Context-specific baseline establishment:

    • Determine normal expression patterns across relevant tissues

    • Establish temporal expression dynamics during development

    • Document circadian or hormone-dependent fluctuations

  • Comprehensive expression analysis:

    • Analyze both mRNA and protein levels to identify post-transcriptional regulation

    • Assess RAMP co-expression to determine functional receptor potential

    • Examine subcellular localization to identify trafficking alterations

  • Correlation with functional outcomes:

    • Link expression changes to receptor activity via signaling assays

    • Correlate with physiological or pathological parameters

    • Determine if expression changes are cause or consequence of disease progression

  • Comparative analysis across models:

    ParameterCell CultureEx Vivo TissueIn Vivo ModelClinical Samples
    Expression rangeLimited by cell typePreserves tissue contextMost physiologically relevantGold standard but variable
    Temporal dynamicsShort-term onlyLimited viabilityCan assess long-term changesTypically single timepoint
    Manipulation potentialHighestModerateLimitedObservational only
    Relevance to diseaseLowestModerateHighHighest

What statistical approaches are most appropriate for analyzing Calcrl expression data in complex experimental designs?

Analyzing Calcrl expression data requires robust statistical approaches tailored to experimental complexity:

Recommended statistical methodologies:

  • For comparing expression levels across groups:

    • Analysis of variance (ANOVA) with appropriate post-hoc tests for multiple comparisons

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) for non-normally distributed data

    • Mixed effects models for repeated measures or nested experimental designs

  • For survival and outcome correlation:

    • Kaplan-Meier analysis with log-rank test for time-to-event outcomes

    • Cox proportional hazards regression for multivariable analysis

    • Competing risk analysis when multiple outcome types are possible

  • For complex covariate adjustment:

    • Multivariable regression with appropriate variable selection methods

    • Propensity score matching to address selection bias in observational studies

    • Mediation analysis to determine direct vs. indirect effects of Calcrl expression

  • For high-dimensional data integration:

    • Principal component analysis to reduce dimensionality

    • Cluster analysis to identify expression patterns across samples

    • Machine learning approaches for predictive modeling

Application example from AML research:
In pediatric AML studies, researchers analyzed associations between CALCRL expression and outcomes using:

  • Kaplan-Meier method with log-rank test for survival probability estimation

  • Multivariable Cox proportional hazards models adjusting for age, white blood cell count, and genetic risk

  • Fine-Gray proportional hazards regression for cumulative incidence of relapse

  • Verification of proportional hazards assumptions using scaled Schoenfeld residuals

This comprehensive statistical approach revealed that high CALCRL expression remained significantly associated with adverse outcomes (HR 1.87 for event-free survival, p=0.0001) even after adjustment for known prognostic factors .

When designing Calcrl studies, researchers should consult with biostatisticians during the planning phase to ensure appropriate statistical power and analysis strategies.

How can findings from rat Calcrl research be effectively translated to human applications?

Translating rat Calcrl research to human applications requires systematic approaches addressing species differences:

Translation framework:

  • Comparative receptor biology assessment:

    • Sequence homology analysis between rat and human Calcrl (protein and gene)

    • Functional comparison of signaling pathways and ligand responses

    • Pharmacological profile comparison using identical compounds

  • Cross-species validation pipeline:

    • Parallel testing in rat and human cell systems

    • Confirmation in human tissue samples or ex vivo preparations

    • Validation in humanized animal models where appropriate

  • Translational biomarker development:

    • Identification of conserved expression patterns across species

    • Development of assays applicable to both preclinical models and clinical samples

    • Correlation of biomarker changes with disease progression in both species

  • Clinical relevance assessment:

    Disease AreaRat Model RelevanceHuman Disease CorrelationTranslation Challenges
    MigraineGood for CGRP pathwaysStrong clinical validationAnatomical differences in trigeminal system
    Cancer (AML)Limited models availableStrong prognostic value establishedGenetic complexity differs between species
    InflammationGenerally good correlationPathway conservationSpecies-specific immune responses
    CardiovascularReliable models availableWell-established roleDifferences in cardiac physiology

The strong prognostic significance of CALCRL in human AML provides a compelling example of translational potential. Its association with worse outcomes across genetic backgrounds suggests it may represent a conserved mechanism related to drug tolerance and relapse . Researchers working with rat models should design experiments that specifically address this potential conserved function to accelerate translation to human applications.

What are the key differences between rat and human Calcrl that researchers should consider when designing translational studies?

Understanding species-specific differences is critical for translational Calcrl research:

Critical species differences:

  • Molecular structure distinctions:

    • Amino acid sequence variations, particularly in ligand binding domains

    • Potential differences in post-translational modification patterns

    • Species-specific alternative splicing variants

  • Pharmacological response variations:

    • Different binding affinities for both endogenous ligands and synthetic compounds

    • Variations in receptor internalization and recycling kinetics

    • Potential differences in biased signaling profiles

  • Expression pattern divergence:

    • Tissue-specific expression level differences

    • Developmental regulation variations

    • Disease-associated expression changes that may not be conserved

  • Physiological role nuances:

    • Species-specific compensatory mechanisms

    • Differences in physiological responses to receptor activation

    • Varied integration with other signaling systems

Design recommendations for translational studies:

  • Early comparative characterization:

    • Direct comparison of rat vs. human receptor pharmacology using identical compounds

    • Parallel testing in species-specific cell systems with matched conditions

    • Structure-function analyses to identify critical conserved domains

  • Humanized systems development:

    • Generation of rat models expressing human CALCRL

    • Creation of chimeric receptors to identify species-specific functional domains

    • Development of cell systems expressing either receptor under identical conditions

  • Translational biomarker validation:

    • Identification of conserved signaling outputs across species

    • Validation of biomarkers in both rat models and human samples

    • Focus on pathways with established cross-species conservation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.