Recombinant Rat Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mitochondrial Physiology

  • ATP-Mg/Pi exchange: Maintains mitochondrial adenine nucleotide pools by importing ATP-Mg and exporting phosphate .

  • Energy metabolism: Supports oxidative phosphorylation and cellular respiration .

  • Stress adaptation: Protects against calcium-induced mitochondrial permeability transition, critical during metabolic stress .

Mechanistic Insights

  • Calcium binding induces structural shifts in the regulatory domain, enabling substrate transport .

  • Loss of SCaMC-2 in mice impairs mitochondrial adenine nucleotide balance, affecting thermogenesis and growth .

Disease Implications

  • Cancer: Overexpression of human homologs (e.g., SLC25A24) aids cancer cell survival by modulating mitochondrial calcium .

  • Neurodegeneration: Murine models show SCaMC-2 deficiency exacerbates neuronal damage under metabolic stress .

Applications in Research

  • In vitro transport assays: Reconstituted liposomes validate calcium-dependent ATP-Mg transport kinetics .

  • Antibody development: Recombinant protein used to generate antibodies for Western blotting and ELISA .

  • Structural studies: Crystallography and NMR analyze calcium-induced conformational changes .

Comparative Analysis with Orthologs

SpeciesProtein NameKey Differences
HumanSCaMC-2 (SLC25A25)Longer N-terminal regulatory domain
MouseSlc25a2592% amino acid identity with rat protein
ZebrafishSlc25a25a/Slc25a25bDuplicated genes with tissue-specific expression

Challenges and Future Directions

  • Structural resolution: Full-length atomic structures of calcium-bound states remain elusive .

  • Therapeutic targeting: Modulating SCaMC-2 activity could address metabolic disorders or cancer, but isoform-specific effects require clarification .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Slc25a25; Mcsc; Pcscl; Scamc2; Calcium-binding mitochondrial carrier protein SCaMC-2; Mitochondrial ATP-Mg/Pi carrier protein; Peroxisomal Ca(2+-dependent solute carrier-like protein; Small calcium-binding mitochondrial carrier protein 2; Solute carrier family 25 member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-469
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a25
Target Protein Sequence
MLCLCLYVPIAGEAQTEFQYFESKGLPTELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIIGGFTQMIREGGAK SLWRGNGINVLKIAPESAIKFMAYEQMKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP MEVLKTRMALRKTGQYSGMLDCAKRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETL KNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. SCaMC-2 may function as an ATP-Mg/Pi exchanger, mediating the exchange of Mg-ATP for phosphate, thereby regulating the net uptake or efflux of adenine nucleotides into or out of the mitochondria.
Gene References Into Functions
  1. a biophysical model of the APC PMID: 23062354
  2. may play an important role in regulating the function of hepatocytes rather than in differentiation in vivo PMID: 12645546
  3. ATP magnesium phosphate carrier, by regulating the matrix adenine nucleotide content, can modulate the sensitivity of rat liver mitochondria to undergo permeability transition PMID: 12851217
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly present in the liver and the skeletal muscle (at protein level).

Q&A

What is the molecular structure of SCaMC-2 and how does it differ from other mitochondrial carriers?

SCaMC-2 (Slc25a25) belongs to the SCaMC subfamily of mitochondrial carriers with a distinctive two-domain structure. Like other SCaMC proteins, it contains a C-terminal transporter domain comprising six transmembrane helices homologous to mitochondrial carrier proteins, and an N-terminal domain with calcium-binding EF hands that faces the intermembrane space . This structure differentiates SCaMCs from other mitochondrial carriers that lack the calcium-sensing domain. The protein's transmembrane region features a three-fold repeated motif of hydrophobic and charged residues, creating a symmetrical foundation for transport channels .

Methodologically, structural analysis of SCaMC-2 typically involves techniques such as X-ray crystallography, cryo-electron microscopy, or computational modeling based on homology with other family members. For functional assays, researchers often use reconstituted proteoliposomes or yeast expression systems lacking endogenous ATP-Mg/Pi carriers to measure transport activity.

What is the primary physiological role of SCaMC-2 in mitochondrial function?

SCaMC-2 functions primarily as an ATP-Mg/Pi carrier in the inner mitochondrial membrane, mediating the exchange of ATP-Mg (or ADP) with phosphate between the cytosol and mitochondrial matrix . This transport activity is regulated by calcium binding to the N-terminal domain, making SCaMC-2 a calcium-sensitive metabolite transporter .

Unlike constitutive ATP/ADP exchange by adenine nucleotide translocases, SCaMC-2-mediated transport responds to calcium signaling events, allowing for dynamic regulation of mitochondrial adenine nucleotide content in response to cellular calcium signals. This regulatory mechanism is crucial for metabolic flexibility and energy homeostasis in tissues with fluctuating energy demands.

How does SCaMC-2 expression vary across different rat tissues?

SCaMC-2 (Slc25a25) shows a tissue-specific expression pattern that differs from other SCaMC family members. While SCaMC-1 is predominantly expressed in cancer cells and SCaMC-3L shows restricted expression mainly in testis and brain , SCaMC-2 has its own distinct tissue distribution pattern.

To properly analyze tissue-specific expression, researchers should:

  • Use quantitative RT-PCR with tissue-specific reference genes for normalization

  • Validate findings with western blot using specific antibodies

  • Consider immunohistochemistry for spatial distribution within tissues

  • Compare expression levels across developmental stages

A comprehensive expression analysis would typically yield tissue distribution patterns that correlate with tissues having fluctuating calcium signaling and high metabolic demands.

What are the optimal conditions for expressing recombinant SCaMC-2 protein with preserved functionality?

Expressing functional recombinant SCaMC-2 requires careful consideration of expression systems and purification methods to maintain the protein's native conformation and activity. The following methodological approach is recommended:

Expression Systems:

  • Prokaryotic systems: E. coli BL21(DE3) with cold induction (18°C) to minimize inclusion body formation

  • Eukaryotic systems: Yeast (S. cerevisiae or P. pastoris) for proper folding of mammalian membrane proteins

  • Mammalian cell lines: HEK293 or CHO cells for mammalian post-translational modifications

Expression Strategy:

  • Use of a mild promoter (tac or tet) rather than strong promoters (T7) to prevent aggregation

  • Inclusion of solubility-enhancing tags (MBP, SUMO) at the N-terminus

  • Co-expression with molecular chaperones (GroEL/GroES)

  • Incorporation of appropriate signal sequences for membrane targeting

Similar approaches have been successful for other SCaMC family members, including the characterization of SCaMC-3L transport activity in yeast deficient in Sal1p . When expressing mitochondrial membrane proteins, maintaining the integrity of transmembrane domains and calcium-binding motifs is crucial for preserving functionality.

How can researchers effectively measure SCaMC-2-mediated ATP-Mg/Pi transport activity in isolated mitochondria?

Measuring SCaMC-2 transport activity requires specific techniques that distinguish its activity from other adenine nucleotide transporters. A systematic approach includes:

  • Mitochondrial isolation protocol:

    • Use differential centrifugation with Percoll gradient purification

    • Verify mitochondrial integrity using cytochrome c oxidase activity assays

    • Assess membrane potential with fluorescent probes (TMRM, JC-1)

  • Transport assay methods:

    • Radioisotope-labeled substrate uptake ([³²P]-Pi, [¹⁴C]-ATP)

    • Luminescence-based ATP detection systems with mitochondrial-targeted luciferase

    • Spectrophotometric measurement of Pi release

  • Distinguishing SCaMC-2 activity:

    • Perform assays at varying Ca²⁺ concentrations to leverage the calcium sensitivity

    • Use specific inhibitors for other transporters (carboxyatractyloside for ANT)

    • Employ SCaMC-2 knockdown or knockout controls

  • Data analysis:

    • Calculate initial transport rates (V₀) under different substrate concentrations

    • Determine Km and Vmax values for ATP-Mg and Pi

    • Analyze calcium concentration-dependent activity curves

This methodological framework allows for reliable assessment of SCaMC-2 transport activity while accounting for potential confounding factors from other mitochondrial transporters.

What are the best approaches for studying SCaMC-2 calcium-binding properties?

The calcium-binding properties of SCaMC-2 are critical for understanding its physiological regulation. Several complementary techniques can be employed:

  • Isothermal Titration Calorimetry (ITC):

    • Directly measures thermodynamic parameters of Ca²⁺ binding

    • Provides dissociation constants (Kd) and binding stoichiometry

    • Requires purified N-terminal domain or full-length protein

  • Fluorescence-based assays:

    • Intrinsic tryptophan fluorescence changes upon calcium binding

    • Calcium indicator dyes (Fura-2, Fluo-4) for monitoring Ca²⁺ binding kinetics

    • FRET-based approaches with strategically placed fluorophores

  • Spectroscopic methods:

    • Circular dichroism (CD) to detect conformational changes upon Ca²⁺ binding

    • NMR spectroscopy for structural insights into calcium-binding EF hands

  • Functional transport assays:

    • ATP-Mg/Pi transport measurements at different [Ca²⁺]

    • Calculation of EC₅₀ values for calcium activation

    • Analysis of cooperativity in calcium-dependent activation

When interpreting calcium-binding data, researchers should consider that SCaMC proteins contain multiple EF-hand motifs with potentially different calcium affinities and cooperativity . Controls using calcium-binding mutants or the isolated N-terminal domain can help verify specificity.

How does SCaMC-2 contribute to mitochondrial calcium homeostasis and its relationship to cell survival pathways?

SCaMC-2, like other SCaMC family members, plays a sophisticated role in mitochondrial calcium homeostasis that extends beyond simple transport. Research methodologies to investigate this relationship include:

  • Mitochondrial calcium capacity studies:

    • Measure calcium retention capacity (CRC) in mitochondria with normal or altered SCaMC-2 expression

    • Assess mitochondrial permeability transition (mPT) sensitivity through calcium-induced swelling assays

    • Investigate how SCaMC-2-mediated adenine nucleotide transport affects matrix calcium buffering

  • Cell survival pathway analysis:

    • SCaMC-1 has been shown to promote cancer cell survival by desensitizing mitochondria to calcium-induced permeability transition

    • Similar mechanisms may apply to SCaMC-2, where its activity provides protection against oxidative stress-induced cell death

    • Methodological approach: compare cell viability after oxidative stress (H₂O₂, menadione) in SCaMC-2 knockdown/overexpression models

  • Mechanistic studies:

    • Investigate how matrix adenine nucleotide levels maintained by SCaMC-2 affect mitochondrial permeability transition pore (mPTP) formation

    • Study interactions between SCaMC-2 activity and known mPTP regulatory factors (cyclophilin D, ATP synthase components)

    • Assess whether SCaMC-2 knockdown increases sensitivity to calcium-dependent cell death, similar to effects observed with SCaMC-1

The role of SCaMC proteins in providing resistance to mPT-dependent cell death represents an important area for advanced research, with potential implications for understanding cellular resilience to stress conditions.

What is the role of SCaMC-2 in metabolic reprogramming during cellular stress conditions?

SCaMC-2's calcium-regulated transport function positions it as a potential metabolic regulator during stress conditions. Investigating this role requires sophisticated experimental designs:

  • Metabolic flux analysis:

    • Use ¹³C-labeled substrates to trace metabolic pathways in cells with modulated SCaMC-2 expression

    • Measure oxygen consumption rates (OCR) and extracellular acidification rates (ECAR) using Seahorse technology

    • Assess changes in ATP/ADP ratios in cytosolic and mitochondrial compartments

  • Stress response experiments:

    • Subject cells to various stressors (nutrient deprivation, hypoxia, oxidative stress)

    • Monitor SCaMC-2 expression/activity changes during stress response

    • Compare metabolic adaptability between wild-type and SCaMC-2-deficient cells

  • Integration with signaling pathways:

    • Investigate coordination between calcium signaling pathways and SCaMC-2 activity

    • Analyze how SCaMC-2 influences retrograde signaling from mitochondria to nucleus

    • Study interaction with stress-responsive transcription factors (HIF-1α, FOXO, NRF2)

  • Analysis of mitochondrial energy status:

    • Measure mitochondrial membrane potential during stress conditions

    • Assess changes in mitochondrial morphology and dynamics

    • Quantify mitochondrial ATP production capacity

Since SLC25 family members influence cellular phenotypes by providing pathways linking cytoplasmic solutes and the mitochondrial matrix , SCaMC-2 likely plays a significant role in metabolic adaptation during stress by regulating matrix adenine nucleotide content in response to calcium signals.

How does post-translational modification affect SCaMC-2 transport activity and regulation?

Post-translational modifications (PTMs) of SCaMC-2 represent an advanced research area with important implications for understanding its regulation. Methodological approaches include:

  • Identification of PTM sites:

    • Mass spectrometry-based proteomics to identify phosphorylation, acetylation, or other modifications

    • Site-directed mutagenesis of predicted modification sites

    • Immunoprecipitation with modification-specific antibodies

  • Functional impact assessment:

    • Compare transport activity of native versus modified protein

    • Analyze calcium sensitivity changes resulting from PTMs

    • Investigate how modifications affect protein-protein interactions

  • Regulatory kinases/enzymes identification:

    • Kinase inhibitor screening to identify pathways regulating SCaMC-2

    • In vitro kinase assays with purified components

    • Co-immunoprecipitation studies to identify interacting regulatory proteins

  • Physiological context:

    • Determine how cellular signaling events trigger SCaMC-2 modifications

    • Investigate tissue-specific or stimulus-dependent modification patterns

    • Study how modifications affect SCaMC-2 degradation or turnover

For comprehensive PTM analysis, researchers should consider approaches that have been successful with other mitochondrial carriers, while acknowledging the unique regulatory features of the calcium-binding domain in SCaMC-2.

How can researchers distinguish between SCaMC-2 activity and other mitochondrial nucleotide transporters in functional studies?

Distinguishing SCaMC-2 activity from other mitochondrial nucleotide transporters presents a significant challenge. A methodical approach includes:

Comparative transport characteristics:

TransporterSubstrate SpecificityCalcium DependenceInhibitor SensitivityKinetic Properties
SCaMC-2 (Slc25a25)ATP-Mg/Pi exchangeCalcium-dependentInsensitive to CAT/BKAModerate affinity
ANT (Slc25a4/5)ADP/ATP exchangeCalcium-independentSensitive to CAT/BKAHigh affinity
SCaMC-3L (Slc25a41)ATP-Mg/Pi exchangeCalcium-independent Insensitive to CAT/BKAModerate affinity

Methodological approaches:

  • Pharmacological distinction:

    • Use carboxyatractyloside (CAT) or bongkrekic acid (BKA) to inhibit ANT activity

    • Leverage the calcium dependence of SCaMC-2 by conducting assays in the presence/absence of calcium

    • Employ matrix pH changes to differentiate H⁺-coupled transport

  • Genetic approaches:

    • Use CRISPR/Cas9 to generate specific knockouts

    • Employ siRNA for transient knockdown with validation of specificity

    • Develop cellular models with inducible expression systems

  • Transport assay design:

    • Measure transport at different calcium concentrations to reveal SCaMC-2 contribution

    • Use reconstituted systems with purified proteins to study individual transporters

    • Analyze substrate competition patterns characteristic of each transporter

  • Data analysis refinements:

    • Apply mathematical modeling to deconvolute mixed transport activities

    • Use principal component analysis to identify distinct transport signatures

    • Implement Bayesian approaches for probability-based activity attribution

This comprehensive approach allows researchers to attribute observed transport phenomena to specific carriers with greater confidence.

What are the common pitfalls in SCaMC-2 functional assays and how can they be addressed?

SCaMC-2 functional studies present several potential pitfalls that require careful methodological considerations:

  • Calcium contamination issues:

    • Problem: Trace calcium in buffers can activate SCaMC-2, confounding "calcium-free" conditions

    • Solution: Use high-quality calcium chelators (EGTA or BAPTA), calcium-free water, and plastic labware to minimize contamination

    • Validation: Measure free calcium concentrations with high-sensitivity calcium indicators (Fura-2)

  • Mitochondrial preparation quality:

    • Problem: Damaged mitochondria can show non-specific permeability or altered transport kinetics

    • Solution: Verify mitochondrial integrity through multiple methods:

      • Respiratory control ratio measurement

      • Membrane potential assessment

      • Cytochrome c release test

      • Electron microscopy for structural integrity

  • Interference from endogenous transporters:

    • Problem: Native transporters can mask or confound SCaMC-2 activity measurements

    • Solution: Design experiments with appropriate controls:

      • Use genetic models with reduced expression of confounding transporters

      • Include specific inhibitors when available

      • Perform parallel assays in mitochondria from SCaMC-2 knockout tissues

  • Substrate purity concerns:

    • Problem: Commercial ATP often contains contaminants (ADP, free phosphate)

    • Solution: Use HPLC-purified substrates or enzymatic systems to remove contaminants

    • Validation: Verify substrate purity before experiments

  • Physiological relevance:

    • Problem: In vitro conditions may not reflect physiological environment

    • Solution: Conduct experiments under conditions that mimic physiological:

      • Use relevant ionic composition

      • Maintain physiological pH

      • Include typical cytosolic proteins or crowding agents

Addressing these methodological challenges ensures more reliable and reproducible assessment of SCaMC-2 function.

How can researchers reconcile contradictory findings about SCaMC-2 function across different experimental models?

Reconciling contradictory findings about SCaMC-2 requires systematic analysis of experimental variables that might explain discrepancies:

  • Species-specific differences:

    • Compare sequence homology and structural features across species

    • Assess conservation of regulatory elements and binding sites

    • Conduct parallel experiments in multiple species using identical protocols

  • Experimental model considerations:

    • Cell/tissue type differences: Expression levels of interacting proteins vary by tissue

    • In vitro vs. in vivo: Reconstituted systems lack the cellular context that may influence function

    • Primary cells vs. cell lines: Immortalized cells often have altered metabolism and signaling

  • Technical variables analysis:

    • Develop a standardized protocol comparison table:

VariableStudy AStudy BStudy CPotential Impact
Buffer compositionHEPES, pH 7.2Tris, pH 7.4Phosphate, pH 7.0Affects ion binding, protein conformation
Temperature25°C37°C30°CInfluences transport kinetics
Calcium concentration100 nM1 μM10 μMChanges activation state
Protein preparationRecombinantNativeOverexpressedMay affect post-translational modifications
  • Integrated data analysis approaches:

    • Meta-analysis of published findings with statistical weighting

    • Development of mathematical models that can account for experimental variables

    • Collaborative validation studies with standardized protocols

  • Biological context consideration:

    • Evaluate whether contradictions reflect true biological flexibility

    • Consider adaptive roles of SCaMC-2 that might explain functional plasticity

    • Investigate regulatory mechanisms that could explain context-dependent functions

When contradictions persist despite methodological harmonization, they may represent important clues about context-dependent regulation or previously unrecognized functional modes of SCaMC-2.

How does SCaMC-2 functionally differ from other SCaMC isoforms in terms of tissue distribution and regulation?

SCaMC-2 exhibits distinct characteristics compared to other SCaMC family members, which can be systematically analyzed:

Tissue distribution comparison:

SCaMC IsoformPredominant Tissue ExpressionCellular LocalizationReference
SCaMC-1Cancer cells, broadly expressed in tumorsMitochondrial inner membrane
SCaMC-2 (Slc25a25)Tissue-specific pattern (varies by species)Mitochondrial inner membrane
SCaMC-3Broadly expressedMitochondrial inner membrane
SCaMC-3L (Slc25a41)Restricted (testis, brain)Mitochondrial inner membrane

Functional and regulatory differences:

  • Calcium sensitivity:

    • SCaMC-1, SCaMC-2, and SCaMC-3 contain N-terminal calcium-binding domains with EF hands

    • SCaMC-3L lacks the calcium-binding N-terminal extension, making its transport activity calcium-independent

    • Methodological approach: Measure transport activity across calcium concentration gradients for each isoform

  • Transport kinetics:

    • Different isoforms may exhibit varied substrate affinities and transport rates

    • Research approach: Conduct comparative kinetic analysis using identical experimental conditions and substrates

  • Physiological roles:

    • SCaMC-1 promotes cancer cell survival by desensitizing mitochondria to calcium-induced permeability transition

    • SCaMC-3L may have evolved more restrictive functions following gene duplication events

    • SCaMC-2 likely has its own specialized physiological functions that merit investigation

For comprehensive analysis, researchers should employ consistent methodologies across isoforms, ideally studying multiple isoforms in parallel using identical experimental conditions.

What evolutionary insights can be gained from comparing SCaMC-2 with other members of the SLC25 carrier family?

Evolutionary analysis of SCaMC-2 in relation to other SLC25 family members provides valuable insights into functional specialization and adaptation:

  • Phylogenetic analysis approaches:

    • Construct maximum-likelihood trees based on transporter domain sequences

    • Compare evolutionary rates across different domains (N-terminal vs. transporter)

    • Analyze selection pressure (dN/dS ratios) across family members

  • Structural evolution insights:

    • The SLC25 family features a three-domain structure with six transmembrane α-helices and a 3-fold repeated motif

    • SCaMC subfamily members evolved the additional N-terminal calcium-binding domain

    • SCaMC-3L emerged through partial gene duplication of SCaMC-3, losing the calcium-binding domain

  • Comparative genomics methods:

    • Analyze synteny around SCaMC genes across species

    • Investigate head-to-tail tandem array arrangements similar to SCaMC-3/SCaMC-3L

    • Examine conservation of regulatory elements in promoter regions

  • Functional divergence analysis:

    • Identify conserved vs. variable residues in substrate-binding regions

    • Compare calcium-binding motifs across SCaMC members

    • Investigate isoform-specific protein interactions

The evolutionary history of SCaMC-2 within the broader SLC25 family (the largest human solute transport protein family with 53 members) provides context for understanding its specialized functions and tissue-specific expression patterns.

How can knowledge about other SLC25 family members inform advanced research approaches for SCaMC-2?

Research on other SLC25 family members provides valuable methodological frameworks and insights that can be applied to SCaMC-2 investigations:

  • Translational research approaches:

    • Several SLC25 members serve as biomarkers for predicting cancer treatment outcomes

    • SCaMC-1 promotes cancer cell survival through mPT resistance

    • Methodological application: Investigate SCaMC-2 expression in disease states and potential as therapeutic target

  • Structure-function relationship studies:

    • Apply successful crystallization strategies from other SLC25 members

    • Utilize homology modeling based on solved structures

    • Implement molecular dynamics simulations to study transport mechanisms

  • Regulatory network analysis:

    • SLC25 transporters influence cellular phenotypes through metabolic connections

    • Some members affect WNT signaling pathways

    • Research direction: Map SCaMC-2 interactions with signaling and metabolic networks

  • Disease relevance investigation:

    • Various SLC25 members are implicated in cancer and other diseases

    • Research approach: Systematic analysis of SCaMC-2 expression and function in disease models

  • Cancer metabolism insights:

    • Many SLC25 transporters promote cancer cell survival and growth by maintaining metabolism

    • Experimental design: Study SCaMC-2 role in metabolic reprogramming of cancer cells

The SLC25 family's diverse roles in metabolism, disease, and cellular signaling provide a rich conceptual framework for designing advanced studies of SCaMC-2, potentially revealing novel functions and therapeutic applications.

What emerging technologies could advance our understanding of SCaMC-2 regulation and function?

Several cutting-edge technologies hold promise for elucidating SCaMC-2 biology:

  • CRISPR-based approaches:

    • CRISPR interference (CRISPRi) for tissue-specific and inducible knockdown

    • Base editing for introducing specific mutations in EF-hand motifs

    • CRISPR activation (CRISPRa) for controlled upregulation

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) for spatial organization studies

    • FRET-based calcium and metabolite sensors targeted to mitochondria

    • Live-cell imaging with genetically encoded indicators for real-time function

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-specific expression patterns

    • Spatial transcriptomics for tissue context understanding

    • Mass cytometry for protein expression at single-cell resolution

  • Structural biology innovations:

    • Cryo-electron microscopy for membrane protein structures

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Computational prediction using AlphaFold or similar AI-based approaches

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Network analysis for contextualizing SCaMC-2 in broader cellular systems

    • Machine learning approaches for predicting functional interactions

These technologies would enable more precise characterization of SCaMC-2 regulation, localization, and function in physiological and pathological contexts.

What are the most promising therapeutic applications of targeting SCaMC-2 in disease contexts?

Based on known functions of SCaMC family members, several therapeutic directions for SCaMC-2 modulation can be proposed:

  • Cancer therapy approaches:

    • SCaMC-1 promotes cancer cell survival by desensitizing mitochondria to calcium-induced cell death

    • Similar mechanisms in SCaMC-2 could make it a potential target in cancers where it is overexpressed

    • Therapeutic strategy: Develop small molecule inhibitors that block transport function or calcium sensing

  • Metabolic disease interventions:

    • SLC25 family members regulate cellular metabolism through mitochondrial substrate transport

    • SCaMC-2 may influence energy homeostasis in tissues with high metabolic demands

    • Research direction: Investigate SCaMC-2 role in metabolic disorders and potential for therapeutic targeting

  • Neuroprotection strategies:

    • Calcium homeostasis and mitochondrial function are critical in neurodegeneration

    • If SCaMC-2 protects against calcium-induced mitochondrial dysfunction, its enhancement could be neuroprotective

    • Experimental approach: Test SCaMC-2 modulation in models of excitotoxicity and neurodegeneration

  • Ischemia-reperfusion injury protection:

    • Mitochondrial calcium overload is a key factor in reperfusion injury

    • SCaMC-2 enhancement might increase mitochondrial calcium buffering capacity

    • Therapeutic potential: Develop activators of SCaMC-2 for use in controlled reperfusion protocols

For all therapeutic applications, careful validation of target specificity and comprehensive understanding of physiological functions will be essential to avoid unintended consequences of SCaMC-2 modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.