Recombinant Rat Calcium release-activated calcium channel protein 1 (Orai1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Orai1; Cracm1; Tmem142a; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MHPEPAPPPNNSNPELPLSGGSSTSGSRRSRRRSGDGEPTGAPPLPPPPAVSYPDWIGQS YSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPGL LIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFS TVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPTEPAVVVANSSNNGGITPGEAAAI ASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPG THYA
Uniprot No.

Target Background

Function
Calcium release-activated calcium (CRAC) channel subunit mediates calcium influx following depletion of intracellular calcium stores. Activation is triggered by the calcium sensor, STIM1. CRAC channels are the primary pathway for calcium influx in T-cells, contributing to the immune response against pathogens by activating the transcription factor NFAT. This protein plays a significant role in calcium influx at the basolateral membrane of mammary epithelial cells, independent of the calcium content of endoplasmic reticulum or Golgi stores. It may mediate transepithelial transport of significant quantities of calcium for milk secretion.
Gene References Into Functions
  1. Reduced Orai1 expression contributes to downregulated calcium entry during lymphocyte excitation, suggesting a potential mechanism for T lymphocyte dysfunction in diabetes. PMID: 29654766
  2. Store-operated calcium channels are linked to diabetic cystopathy in streptozotocin-induced diabetic rats. PMID: 29532875
  3. These findings demonstrate that NEFA-sensitive NFkappaB-dependent Orai1 expression regulates de novo lipogenesis. PMID: 29913436
  4. Using a dominant-negative form of ORAI1, it was shown that ORAI1 is required for the formation of new dendritic spines following chemical induction of long-term potentiation (cLTP). This effect is attributed to the release of Ca(+2) from ryanodine receptor-associated endoplasmic reticulum stores. PMID: 28189550
  5. Hypertrophic aortic remodeling and abnormal contraction, primarily triggered by Ca2+ overload via STIM-1/Orai-1-mediated SOCE through SOCCs, are implicated in hypertension developed by EtOH consumption. PMID: 28155613
  6. Ang-II-induced Egr-1 expression is mediated by STIM-1/Orai-1/Ca(2+) -dependent signaling pathways in vascular smooth muscle cells. PMID: 28105751
  7. Calcium influx through Orai1 channels facilitates the maturation of dendritic spines and the formation of functional synapses in central neurons. PMID: 27393042
  8. Neuronal aging is associated with increased ER-mitochondrial crosstalk and loss of store-operated calcium entry via Stim1/Orai1. PMID: 27503411
  9. In endotoxemia, Ca(2+) homeostasis is disrupted in VSMC, characterized by decreased Ca(2+) influx, lower concentrations of Ca(2+) in the sarcoplasmic reticulum, and reduced activation of Orai1. PMID: 27099074
  10. Store-operated calcium entry may play a crucial role in severe acute pancreatitis-associated acute lung injury. The protective effects of inhibiting SOC proteins Orai1 and STIM1 may be mediated, at least partially, by restraining mitochondrial-associated apoptosis of pulmonary microvascular endothelial cells. PMID: 27025854
  11. Orai1 gene expression is upregulated by aldosterone in rat cardiomyocytes. PMID: 27129253
  12. Orai1 forms a complex with BKCa in the mesenteric artery smooth muscle. PMID: 26755740
  13. Stim1/Orai1 function is altered in vascular smooth muscle from mesenteric arteries and aorta with aging. PMID: 25636074
  14. STIM1/Orai1 blockade could alleviate alcohol-induced hepatotoxicity by inhibiting apoptosis. PMID: 26033013
  15. Leukotriene-C4 synthase, a critical enzyme in the activation of store-independent Orai1/Orai3 channels, is required for neointimal hyperplasia. PMID: 25540197
  16. This study demonstrates that sodium permeates activated store-operated calcium entry channels, resulting in an increase in cytosolic sodium. The magnitude of this response is determined by Orai1. PMID: 25428882
  17. This study demonstrated that inhibition of orai1 expression decreased the intracellular calcium concentration in neurons. PMID: 24509424
  18. The attenuation of GMCs proliferation can be attributed to the decreased SOCE partially caused by reduced expression of STIM 1 and Orai 1. PMID: 23334602
  19. The second coiled-coil domain of STIM1 is required for coupling to either Orai3 or Orai3/Orai1 channels. PMID: 23878392
  20. In neuronal somata, the formation of endogenous complexes of stromal interaction molecule 2 (STIM2) with ORAI1 calcium channels is observed. PMID: 23711249
  21. Orai channels are activated by different agonists/pathways. This study reveals a mechanism whereby leukotrieneC4 acts through a previously unknown intracrine mode to elicit store-independent Ca(2+) signaling that promotes vascular occlusive disease. PMID: 23349245
  22. Overexpression of Orai1 increased by twofold the Ca(2+) influx evoked by thrombin, while knockdown of endogenous Orai1 significantly decreased this Ca(2+) influx. PMID: 22944608
  23. This study reports Orai1 expression in hippocampal neurons in response to corticosterone. PMID: 23169006
  24. This research demonstrates that Ca(2+) influx via Orai1 plays a crucial role in regulating spontaneous motility and directional migration of mast cells. PMID: 22859829
  25. Knockdown of genes encoding Trpc1, Orai1, and Stim1, but not Trpc6, substantially reduced (up to 60%) the frequency of PGF(2alpha)-induced Ca(2+) oscillations in normal rat kidney cells. PMID: 22050845
  26. Stim1- and Orai1-mediated store-operated calcium entry is critical for angiotensin II-induced vascular smooth muscle cell proliferation. PMID: 22108917
  27. Calcium entry via ORAI1 is essential for glioblastoma proliferation and survival. PMID: 21945734
  28. Augmented activation of STIM1/Orai1 in aortas from male SHRSP represents a mechanism that contributes to sex-related impaired control of intracellular Ca2+ levels. PMID: 21966957
  29. Store-depletion-stimulated STIM1-Orai1 association is positively regulated by the ordered lipid pool of PtdIns(4,5)P(2) and negatively regulated by PtdIns(4,5)P(2) in disordered lipid domains. PMID: 21750194
  30. Orai1 is upregulated in vascular smooth muscle cells (VSMC) during vascular injury and is required for VSMC proliferation and neointima formation following balloon injury of rat carotids. PMID: 21737791
  31. Suppression of store-operated channels function by Orai1 overexpression likely reflects a required stoichiometry between STIM1 and Orai1. PMID: 16766533
  32. Dynamic assembly of the TRPC1-STIM1-Orai1 ternary complex is involved in the activation of SOC channels in response to internal Ca2+ store depletion. PMID: 17224452
  33. These results suggest that STIM1/Orai1-mediated SOCE is involved in ASMC proliferation. PMID: 21330611
  34. Both Orai1 and Stim1 have a key role in cardiomyocyte store-operated Ca(2+) entry regulating both normal and hypertrophic postnatal cardiac growth in vitro. PMID: 20138887
  35. STIM1 activation by store depletion or mutational modification suppresses Ca(V)1.2 channels while activating store-operated Orai channels. STIM1 interacts with and reciprocally controls two major calcium channels previously thought to operate independently. PMID: 20929813
  36. These results establish the role of STIM1 and Orai1 in vascular smooth muscle cell movement and vascular injury repair. PMID: 20107038
  37. Data challenge the idea of direct conformational coupling between STIM1 and Orai1 as a viable mechanism of puncta formation and SOCE activation, uncovering greater complexity in their relationship. PMID: 18768920
  38. Knockdown of Orai1 protein inhibits endothelial proliferation and causes cell cycle arrest at S and G2/M phase. PMID: 18845811
  39. Results reveal dynamic molecular interactions between STIM1 and Orai1/CRACM1 that depend quantitatively on electrostatic interactions and on the extent of store depletion. PMID: 18987344
  40. Both Orai-1 and STIM-1 contribute to abnormal vascular function in hypertension. Augmented activation of STIM-1/Orai-1 may represent the mechanism that leads to impaired control of intracellular Ca(2+) levels in hypertension. PMID: 19075091
  41. This study provides evidence for two cytosolic key regions within STIM1 C terminus that control ORAI1/CRAC activation: a homomerization domain indispensable for coupling to ORAI1 and a modulatory domain that controls the extent of coupling to ORAI1. PMID: 19189966
  42. This study provides evidence for STIM1- and Orai1-dependent store-operated calcium influx through ICRAC in vascular smooth muscle cells, highlighting its role in proliferation and migration. PMID: 19364762

Show More

Hide All

Database Links
Protein Families
Orai family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Orai1 and how does it form functional CRAC channels?

Orai1 is a plasma membrane protein with four transmembrane (TM) domains that assembles into a hexameric structure to form the pore of CRAC channels. The crystal structure analysis reveals that the TM1 segment lines the ion conduction pathway, while TM2, TM3, and TM4 form the outer shell of the channel complex. The pore contains a hydrophobic region centered around residues V102 and F99 that forms a gating checkpoint critical for channel function .

Functional CRAC channels require both Orai1 and STIM1 (Stromal Interaction Molecule 1), an ER-resident calcium sensor. Upon ER calcium depletion, STIM1 oligomerizes and translocates to ER-plasma membrane junctions where it interacts with and activates Orai1 through a region called the CRAC Activation Domain (CAD) or STIM1 Orai1 Activating Region (SOAR) . This interaction induces conformational changes in Orai1, including rotation of the TM1 helix and hydration of the hydrophobic pore region, allowing calcium ions to flow through the channel .

How do the different domains of Orai1 contribute to its function?

Each transmembrane domain of Orai1 serves distinct functions in channel assembly and gating:

DomainLocationPrimary Functions
TM1Inner pore-lining segmentForms the ion conduction pathway; contains critical residues for ion selectivity and gating (E106, F99, V102)
TM2Outer shellStabilizes channel structure; contains residues (e.g., H134) that can affect gating when mutated
TM3Outer shellMediates interactions with other TM domains; mutations (e.g., W176C, E190C) can alter ion selectivity
TM4Outermost segmentDespite being 20-25Å from the pore, contains residues (A235C, P245C) that influence channel gating
N-terminusCytosolic regionContains binding sites for regulatory partners; involved in channel assembly
C-terminusCytosolic regionContains STIM1 binding sites; critical for channel activation

Mutations in various domains can result in constitutively active gain-of-function phenotypes with varying levels of ion selectivity, suggesting that conformational changes throughout the protein contribute to channel gating .

What are the most effective expression systems for producing functional recombinant rat Orai1?

For recombinant rat Orai1 expression, several systems have proven effective, each with distinct advantages for different experimental applications:

Mammalian expression systems (HEK293, CHO cells) provide the most physiologically relevant post-translational modifications and protein folding machinery for functional studies. These systems are optimal when studying Orai1 electrophysiological properties or interactions with mammalian proteins like STIM1. Transfection efficiency can be optimized using lipid-based reagents or viral vectors with expression typically peaking 24-48 hours post-transfection .

For structural studies requiring larger protein yields, insect cell (Sf9, High Five) expression systems using baculovirus vectors can be employed. These systems maintain most mammalian-like post-translational modifications while allowing scaling to larger culture volumes.

For biochemical studies, yeast expression systems (particularly S. cerevisiae) have successfully been used to reconstitute Orai1 in membrane vesicles that allow functional studies when combined with purified STIM1 fragments .

What purification strategies overcome the challenges associated with membrane protein isolation while maintaining Orai1 functionality?

Purifying functional Orai1 requires careful consideration of detergent selection and stabilization strategies:

  • Detergent screening is critical—mild detergents like DDM (n-dodecyl-β-D-maltoside), LMNG (lauryl maltose neopentyl glycol), or digitonin better preserve Orai1 structure compared to harsher detergents like Triton X-100.

  • Addition of cholesterol or specific lipids during purification helps maintain the native-like membrane environment.

  • For functional studies, reconstitution into proteoliposomes or nanodiscs after purification better preserves channel properties than detergent micelles alone.

  • When studying Orai1-STIM1 interactions, co-expression and co-purification strategies yield better results than reconstituting the components separately.

  • If studying rat Orai1 specifically, optimization of buffer conditions to match rat physiological parameters (pH, ionic strength) can improve stability during purification.

The purified protein should be validated for proper folding using circular dichroism spectroscopy and functional integrity through calcium flux assays or electrophysiological measurements when reconstituted into artificial membranes .

What are the most reliable techniques for measuring CRAC channel activity in systems expressing recombinant Orai1?

Several complementary techniques have been established for assessing CRAC channel function:

Patch-clamp electrophysiology remains the gold standard for directly measuring Orai1-mediated currents. Whole-cell configuration allows measurement of characteristic CRAC currents with high temporal resolution, distinguished by their inwardly rectifying current-voltage relationship and positive reversal potential (>35mV) . This technique can detect subtle differences in channel properties resulting from mutations or molecular interventions.

Calcium imaging using fluorescent indicators (Fura-2, Fluo-4) provides a more accessible approach for monitoring SOCE in cell populations. The typical protocol involves:

  • Depleting ER calcium stores in calcium-free medium (using thapsigargin or IP3-generating agonists)

  • Reintroducing extracellular calcium to measure the resulting calcium influx

  • Analyzing the magnitude and kinetics of the calcium rise as indicators of CRAC channel function

Mn²⁺ quench assays offer an alternative approach by measuring the quenching of fura-2 fluorescence by Mn²⁺ entry through CRAC channels, providing a measure of divalent cation permeability independent of calcium-dependent feedback mechanisms.

For higher throughput screening, FLIPR (Fluorescent Imaging Plate Reader) systems allow simultaneous calcium measurements across multi-well plates, useful for comparing multiple conditions or compound treatments .

How can researchers effectively study Orai1-STIM1 interactions and the dynamics of CRAC channel formation?

Understanding the dynamic process of STIM1-Orai1 interactions requires specialized techniques:

FRET (Förster Resonance Energy Transfer) between fluorescently-tagged Orai1 and STIM1 provides real-time monitoring of protein interactions with sub-nanometer resolution. CFP-Orai1 and YFP-STIM1 constructs are commonly used, with FRET efficiency increasing upon store depletion as the proteins interact. This approach can be combined with electrophysiology to correlate molecular interactions with channel function .

Total Internal Reflection Fluorescence (TIRF) microscopy allows visualization of Orai1-STIM1 clustering at ER-PM junctions with high spatial resolution, ideal for studying the redistribution of these proteins following store depletion.

Biochemical crosslinking followed by co-immunoprecipitation or pull-down assays can identify specific interaction domains and associated proteins in the macromolecular complex. Chemical crosslinkers with varying arm lengths have revealed that Orai1 exists in a complex with an 11-14nm protrusion into the cytoplasm .

Surface Plasmon Resonance (SPR) with purified components can determine binding kinetics and affinities between Orai1 domains and STIM1 fragments, revealing how specific mutations affect these interactions .

How do Orai1, Orai2, and Orai3 differ in their contributions to native CRAC channel function?

The Orai family consists of three homologs (Orai1, Orai2, and Orai3) that contribute differently to SOCE in various cell types:

PropertyOrai1Orai2Orai3
Expression patternWidely expressedTissue-specificTissue-specific
Contribution to SOCEMajor component in most cellsVariable, cell-type dependentMinor in most cells, but significant in some contexts
STIM1 sensitivityHighModerateHigh
2-APB sensitivityInhibited at >50μMVariableActivated
Redox sensitivityHigh (C195)LowerResistant

In B cells specifically, recent research using B cell-specific knockout models has demonstrated that both Orai1 and Orai3 contribute significantly to native CRAC channels. Interestingly, while B cell activation upregulates both Orai1 and Orai3 expression, it downregulates Orai2 expression. The combined deletion of both Orai1 and Orai3, but not either alone, led to significant reduction in B cell proliferation and survival, suggesting functional redundancy between these homologs .

This functional overlap explains why Orai1 knockout alone shows only partial effects on calcium signaling in some cell types, as Orai3 can partially compensate for Orai1 deficiency. The specific contribution of each homolog appears to be regulated through dynamic changes in their expression patterns during cellular activation .

What experimental approaches best distinguish between the functional contributions of different Orai homologs?

Differentiating between Orai homolog contributions requires specialized approaches:

Isoform-specific gene targeting using CRISPR/Cas9 to generate single and combined knockouts provides the clearest picture of individual contributions. Studies in B cells have employed this approach to demonstrate the overlapping roles of Orai1 and Orai3 .

Pharmacological discrimination can be achieved using 2-aminoethoxydiphenyl borate (2-APB), which inhibits Orai1 at higher concentrations (>50μM) but activates Orai3, providing a tool to distinguish their relative contributions to calcium signals.

Redox sensitivity testing exploits the differential sensitivity of Orai homologs to oxidative stress (Orai1 being most sensitive due to a critical cysteine at position 195, which is absent in Orai3). Comparing SOCE under reducing and oxidizing conditions can help determine the contribution of Orai1 versus Orai3.

Quantitative PCR and western blotting with isoform-specific antibodies can track expression changes of individual Orai homologs during cellular processes, as demonstrated in B cell activation studies showing reciprocal regulation of Orai1/3 (upregulated) and Orai2 (downregulated) .

Electrophysiological fingerprinting based on subtle differences in channel properties (ion selectivity, inactivation kinetics) between homologs can help identify which isoforms dominate in a particular cell type or condition.

What are the key gain-of-function and loss-of-function mutations in Orai1 and how do they affect channel properties?

Extensive mutational analysis has identified several critical residues that dramatically alter Orai1 function:

Gain-of-function (GOF) mutations create constitutively active channels independent of STIM1 and store depletion. Notable examples include:

  • S97C in TM1 (non-pore-lining face): Linked to tubular aggregate myopathy with congenital miosis; exhibits high calcium selectivity similar to wild-type channels activated by STIM1

  • H134C in TM2: Creates constitutively active channels with high calcium selectivity

  • W176C and E190C in TM3: Generate constitutively active channels with altered ion selectivity, showing substantial outward currents at positive potentials

  • A235C and P245C in TM4: Despite being 20-25Å from the pore, mutations at these positions create constitutively active channels; P245C is linked to tubular aggregate myopathy

Loss-of-function (LOF) mutations impair channel function and include:

  • R91W: A naturally occurring mutation that causes severe combined immunodeficiency due to defective CRAC channel function in immune cells

  • E106A/D: Mutations at this selectivity filter residue dramatically reduce calcium permeability

  • Mutations disrupting STIM1 binding sites in the C-terminal region: Prevent channel activation despite normal trafficking

Molecular dynamics simulations have revealed that many GOF mutations increase pore hydration in the hydrophobic section (around V102 and F99) and induce TM1 helix rotation, lowering the energy barrier for ion conduction . The wide distribution of GOF mutations throughout all four TM domains suggests that channel gating involves coordinated conformational changes throughout the protein structure.

How can researchers effectively introduce and validate specific mutations in recombinant rat Orai1?

Creating and validating mutations in rat Orai1 requires systematic approaches:

For mutation introduction:

  • Site-directed mutagenesis using PCR-based methods remains the gold standard for introducing specific point mutations

  • CRISPR/Cas9 gene editing can be employed for creating cellular models with endogenous mutations

  • Gibson Assembly or similar techniques are preferable when introducing multiple mutations or larger sequence modifications

For functional validation:

  • Electrophysiological characterization should assess:

    • Current-voltage relationships to evaluate ion selectivity (particularly the reversal potential)

    • Current density to quantify channel expression and function

    • Calcium-dependent inactivation properties

    • Sensitivity to known CRAC channel blockers

  • Calcium imaging should examine:

    • Store-operated vs constitutive calcium entry

    • Response to store depletion agents

    • Kinetics of calcium signals

  • Molecular validation should include:

    • Protein expression levels by western blot

    • Cellular localization by immunofluorescence or fluorescent protein tagging

    • Glycosylation status to assess proper protein processing

    • STIM1 interaction capability by co-immunoprecipitation or FRET

When comparing multiple mutations, standardization of expression levels is critical as overexpression can mask subtle functional differences. Using inducible expression systems can help address this challenge .

What proteins interact with Orai1 to regulate CRAC channel function beyond STIM1?

While Orai1 and STIM1 form the core components of CRAC channels, numerous additional proteins interact with and regulate this complex:

CRACR2A (CRAC Regulator 2A) is a cytosolic calcium-binding protein that stabilizes the Orai1-STIM1 interaction at low calcium concentrations, enhancing SOCE. As calcium levels rise, CRACR2A dissociates from the complex, providing a negative feedback mechanism .

SARAF (SOCE-Associated Regulatory Factor) interacts with STIM1 to mediate calcium-dependent inactivation of Orai1 channels, preventing excessive calcium entry. This requires the translocation of SARAF from the ER to the ER-PM junctions .

ERp57, an ER-resident protein, binds to the luminal domain of STIM1 and negatively regulates SOCE. Increased SOCE has been observed in ERp57-deficient cells, suggesting its inhibitory role in STIM1 function .

Caveolin interacts with the N-terminus of Orai1 and regulates its internalization through a caveolin and dynamin-dependent pathway, controlling surface expression levels of the channel .

Calmodulin binds to the N-terminus of Orai1 and contributes to calcium-dependent inactivation, providing another layer of feedback regulation.

SPCA2 (Secretory Pathway Ca²⁺-ATPase 2) can activate Orai1 in a store-independent manner, particularly in mammary tumor cells, suggesting alternative activation mechanisms beyond store depletion .

These interactions form part of a complex regulatory network that fine-tunes calcium entry in response to various cellular signals and conditions.

How does the macromolecular assembly of Orai1 affect experimental approaches to studying its function?

The existence of Orai1 in macromolecular complexes presents unique experimental challenges:

Size and composition considerations:
Studies using chemical cross-linking and glycerol gradient fractionation have identified Orai1 and STIM1 in large protein complexes. Research using chemically inducible bridge formation demonstrated that Orai1 exists in a complex with 11-14 nm protrusion into the cytoplasm . This macromolecular nature necessitates approaches that preserve these complex interactions.

Experimental implications:

  • Purification strategies must account for the multi-protein nature of functional complexes; mild solubilization conditions and stabilizing additives are essential to maintain native interactions

  • Reconstitution systems require sufficient space to accommodate the entire complex; larger nanodiscs or GUVs (Giant Unilamellar Vesicles) may be preferable to smaller proteoliposomes

  • Structural studies face challenges due to the dynamic and heterogeneous nature of these complexes; cryo-electron microscopy and cross-linking mass spectrometry are often more suitable than crystallography

  • Functional studies should consider that loss of interacting partners may alter Orai1 behavior; native membrane preparations or minimally perturbing techniques like perforated patch recording may better preserve physiological function

  • Protein-protein interaction studies must account for potential false positives in pull-down experiments, as membrane proteins tend to interact non-specifically; multiple complementary approaches (FRET, proximity labeling, co-immunoprecipitation with appropriate controls) provide more reliable results

How does Orai1 function differ across various cell types and physiological contexts?

Orai1 plays diverse roles across different tissues and cellular contexts:

Immune cells: Orai1-mediated SOCE is critical for T cell and B cell activation. In B cells, recent studies show that Orai1 works together with Orai3 to regulate NFAT translocation, metabolism, and proliferation. Interestingly, while initial SOCE may not require Orai1 specifically in B cells, sustained calcium signals and downstream transcriptional responses are Orai1-dependent .

Muscle cells: Orai1 contributes to calcium homeostasis in skeletal and cardiac muscle. Gain-of-function mutations in Orai1 (S97C, P245C) are associated with tubular aggregate myopathy, characterized by muscle weakness and miosis .

Cancer cells: Altered Orai1 expression and function are observed in various cancers. In mammary tumors, SPCA2 can activate Orai1 in a store-independent manner, promoting calcium entry and tumor growth .

Platelets: Orai1-mediated calcium entry is essential for platelet activation and thrombus formation, making it relevant to hemostasis and thrombotic disorders.

Neural progenitor cells: Orai1 regulates calcium signals important for proliferation and differentiation during neural development .

These diverse roles highlight the importance of studying Orai1 in cell type-specific contexts, as its function, regulation, and molecular partnerships can vary significantly between tissues.

What are the implications of Orai1 dysfunction in disease models and how can recombinant Orai1 be used in therapeutic development?

Orai1 dysfunction has been implicated in several pathological conditions:

Immunodeficiency: Loss-of-function mutations in Orai1 cause severe combined immunodeficiency characterized by recurrent infections and impaired T cell activation. Recombinant Orai1 systems can be used to screen for compounds that might rescue partial function of mutant channels.

Autoimmune disorders: Excessive CRAC channel activity contributes to hyperactive immune responses. Recombinant Orai1 expression systems are valuable for high-throughput screening of potential inhibitors that could be developed as immunosuppressive agents.

Muscle disorders: Gain-of-function Orai1 mutations cause tubular aggregate myopathy. Expressing these mutants in cellular models helps elucidate pathogenic mechanisms and test potential therapies aimed at normalizing calcium homeostasis.

Cancer: Altered Orai1 expression in various cancers affects proliferation, migration, and apoptosis resistance. Recombinant systems allow testing of isoform-specific modulators that might selectively target cancer cells while sparing normal tissues.

Thrombotic disorders: Orai1 involvement in platelet activation makes it a potential target for novel antithrombotic agents. Recombinant expression in megakaryocyte models provides platforms for evaluating compounds that might inhibit platelet-specific calcium entry.

For therapeutic development, recombinant rat Orai1 offers advantages over human Orai1 in certain contexts, particularly for preclinical studies in rat disease models where species-matched proteins better recapitulate native interactions and functions.

What are the current technical limitations in studying recombinant Orai1 and potential strategies to overcome them?

Several technical challenges complicate Orai1 research:

Structural flexibility and dynamics make it difficult to capture the full range of conformational states using static structural methods. Emerging approaches like cryo-electron microscopy with multiple particle classification, single-molecule FRET, and molecular dynamics simulations can better capture the dynamic nature of channel gating .

Low expression levels of functional channels often limit biochemical and structural studies. This can be addressed through:

  • Optimizing codon usage for the expression system

  • Using inducible expression systems to minimize toxicity

  • Incorporating stability-enhancing mutations that don't affect function

  • Developing better purification tags and strategies specific for Orai1

Accurate functional assessment is complicated by endogenous Orai homologs in most expression systems. Strategies to address this include:

  • Using CRISPR/Cas9 to knock out endogenous Orai proteins in expression cell lines

  • Developing more specific antibodies and pharmacological tools to distinguish between homologs

  • Creating function-specific assays that can distinguish recombinant from endogenous channels

Heterogeneity in STIM1 interaction can create variable channel properties. This can be addressed through:

  • Co-expression with defined STIM1 constructs

  • Using synthetic STIM1 fragments (CAD/SOAR) that activate Orai1 independently of store depletion

  • Developing systems with controlled stoichiometry between Orai1 and STIM1

How can researchers integrate multiple experimental approaches to build comprehensive models of Orai1 function?

A multi-faceted approach provides the most complete understanding of Orai1 function:

Integrative structural biology combines:

Together, these methods can reveal how mutations affect pore hydration, helix rotation, and other structural parameters linked to channel function .

Functional assessment should combine:

  • Electrophysiology for direct measurement of channel properties

  • Calcium imaging for cellular responses in intact cells

  • Biochemical assays for protein interactions

  • Gene expression analysis for downstream effects

Physiological relevance requires:

  • Studies in relevant primary cells (not just overexpression systems)

  • Conditional knockout models to examine tissue-specific roles

  • Disease-associated mutations to connect structure to pathophysiology

Data integration can be enhanced through computational approaches like systems biology modeling that incorporate calcium dynamics, downstream signaling, and feedback regulation into unified models.

Recent studies demonstrate the power of this integrated approach—combining electrophysiology, molecular dynamics simulations, and mutation analysis has revealed how structural changes in the hydrophobic pore region correlate with functional outcomes, providing deeper insight into the gating mechanism than any single technique could achieve .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.