Recombinant Rat Calnexin (Canx)

Shipped with Ice Packs
In Stock

Description

Research Applications and Findings

Recombinant Rat CANX is employed in studies addressing ER stress, neurodegeneration, and immune dysfunction.

Protein Folding and ER Quality Control

  • Glycoprotein Retention: Binds monoglucosylated glycoproteins via its C-terminal domain, preventing premature secretion .

  • Disease Models:

    • Cystic Fibrosis: Dysfunctional calnexin leads to CFTR degradation. Recombinant CANX helps study misfolding mechanisms .

    • Charcot-Marie-Tooth Disease: Mutant PMP22 sequestration by calnexin exacerbates myelination defects .

Immunological Roles

  • MHC Class I Assembly: Associates with tapasin and ERp57 to stabilize MHC class I α-chains during antigen loading .

  • Autoimmune Diseases:

    • Experimental Autoimmune Encephalomyelitis (EAE): Calnexin-deficient mice show impaired T cell transmigration into the CNS, reducing EAE severity .

ApplicationKey FindingsSource
ER Stress in NeurodegenerationCalnexin decline with aging links to Alzheimer’s and ALS pathogenesis .
Cancer BiomarkerElevated calnexin levels correlate with prognosis in colorectal and lung cancers .
Endocytosis RegulationCalnexin interacts with SGIP1 to inhibit clathrin-dependent endocytosis in neurons .

Disease Associations and Biomarker Potential

Calnexin dysregulation is implicated in multiple pathologies, as summarized below:

DiseaseMechanismRelevance to Rat Models
Cystic FibrosisCFTR misfolding and degradationStudied via recombinant CANX binding assays .
NeurodegenerationER stress in Alzheimer’s, ALS, and Parkinson’sAging models in rodents .
Autoimmune DisordersT cell transmigration defects in EAECalnexin-deficient mice show resistance .
CancerDysregulated glycoprotein foldingPrognostic biomarker in lung/breast cancers .

Analytical Methods for CANX Detection

Recombinant Rat CANX is utilized in assays to study its expression and function:

ELISA Kits

  • Assay Genie Rat CANX ELISA Kit (RTEB0199):

    • Detection Range: 0.625–40 ng/mL.

    • Sensitivity: 0.317 ng/mL.

    • Applications: Quantify calnexin in serum, plasma, or cell lysates .

ParameterValue
Sample TypesSerum, plasma, cell lysates
Cross-ReactivityRat-specific
Assay TypeSandwich ELISA

Antibodies

  • Polyclonal Antibodies (e.g., ab227310, BSM-52639R):

    • Applications: Western blot, IHC, IF.

    • Reactivity: Human, rat, mouse .

    • Predicted Band Size: 68 kDa (non-glycosylated) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Canx; Calnexin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-591
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
HDGHDDDMIDIEDDLDDVIEEVEDSKSKSDTSTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKGDEEEEEEKLEEKQKSDAEEDGGTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE
Uniprot No.

Target Background

Function
Calnexin is a calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may facilitate protein assembly and/or retain unassembled protein subunits within the ER. It plays a crucial role in the quality control mechanisms of the ER by retaining misfolded proteins. Calnexin is associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, potentially acting as a signaling complex regulating thymocyte maturation. Additionally, it may contribute to receptor-mediated endocytosis at the synapse.
Gene References Into Functions
  1. Our findings indicate that obesity down-regulates CNX and CRT expressions and their activities, while diabetes up-regulates the expressions and activities of CNX and CRT. These results suggest that metabolic syndrome affects the lectin-like chaperones in the CNX/CRT cycle at both the activity and expression levels. PMID: 27425249
  2. Calnexin localizes to the neuronal cell membrane, and this recruitment is regulated in an NMDA receptor-dependent manner. Immunoisolation of vesicles revealed co-localization of GluA2 and calnexin in post-ER intracellular membrane components. PMID: 23851254
  3. Transmembrane segments prevent surface expression of sodium channel Nav1.8 and promote calnexin-dependent channel degradation. PMID: 20720009
  4. Endoplasmic reticulum stress has effects on group VIA phospholipase A2 in beta cells that include tyrosine phosphorylation and increased association with calnexin. PMID: 20732873
  5. Two new complementary roles for calcineurin in the regulation of the early UPR (Unfolded Protein Responses) have been identified. PMID: 20700529
  6. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  7. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
  8. Data provide novel evidence that CyCAP regulates the post-translational modification of tissue transglutaminase through its colocalization with calnexin in the endoplasmic reticulum. PMID: 20049854
  9. Mixed disulfides with the ERp57 oxidoreductase act in conjunction with calreticulin/calnexin chaperones as normal early Tg folding intermediates. PMID: 16260597
  10. These results suggest that MCF-7 resistance to endoplasmic reticulum stress-induced apoptosis is partially mediated by the expression level of calnexin, which in turn controls its sub-cellular localization and its association with Bap31. PMID: 17203246

Show More

Hide All

Database Links

KEGG: rno:29144

STRING: 10116.ENSRNOP00000040859

UniGene: Rn.1762

Protein Families
Calreticulin family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Melanosome.

Q&A

What is Rat Calnexin and what are its primary functions in cellular systems?

Rat Calnexin is a calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum (ER). Its primary functions include assisting protein assembly, retaining unassembled protein subunits within the ER, and playing a major role in quality control by retaining incorrectly folded proteins . Additionally, calnexin may function as part of a signaling complex regulating thymocyte maturation and potentially plays a role in receptor-mediated endocytosis at the synapse . The protein has a molecular weight of approximately 90 kDa and is encoded by the CANX gene (Gene ID: 821) .

Calnexin's chaperone function is central to cellular protein homeostasis, as it monitors glycoprotein folding and prevents the release of incompletely folded proteins from the ER. This quality control mechanism is essential for maintaining proper cellular function and preventing protein aggregation that could lead to pathological conditions.

How does Rat Calnexin differ structurally and functionally from human and mouse homologs?

While rat, human, and mouse calnexin share significant homology, there are species-specific differences that researchers should consider when selecting experimental models. Most antibodies demonstrate cross-reactivity between species, with many commercial antibodies recognizing epitopes in multiple species including human, rat, and mouse .

The high degree of conservation suggests similar core functions across species, though subtle differences may exist in tissue-specific interactions, particularly in specialized tissues like the neuronal system. Researchers working with rat calnexin should select antibodies with validated reactivity to rat samples, as demonstrated in several commercially available options .

SpeciesMolecular WeightTypical ApplicationsValidated Antibody Reactivity
Rat~90 kDaWB, IHC, IF, FCMYes
Human~90 kDaWB, IHC, IFYes
Mouse~90 kDaWB, IHC, IFYes (some antibodies)

What are the optimal experimental conditions for working with Recombinant Rat Calnexin antibodies?

For optimal results when working with recombinant rat calnexin antibodies, researchers should consider application-specific conditions:

ApplicationRecommended DilutionKey Considerations
Western Blotting (WB)1:300-5000 or 1:1000 Use 7.5% SDS-PAGE gels for optimal resolution
Flow Cytometry (FCM)1:20-100 Cell permeabilization required
Immunohistochemistry (IHC-P)1:200-400 or 1:200-800 Proper antigen retrieval critical
Immunofluorescence (IF/ICC)1:50-200 or 1:50-100 Co-staining with ER markers recommended

When selecting antibodies, researchers should prioritize those with demonstrated specificity and reproducibility. Recombinant antibodies may offer superior lot-to-lot consistency compared to traditional monoclonal or polyclonal antibodies . Storage conditions typically involve keeping antibodies at -20°C with 50% glycerol to prevent freeze-thaw damage .

What protocols are recommended for immunofluorescence studies of Rat Calnexin in neuronal cells?

For effective immunofluorescence studies of rat calnexin in neuronal cells, researchers should follow these methodological steps:

  • Sample Preparation:

    • Fix cells or tissue sections with freshly prepared solution of 2.5% glutaraldehyde and 2% paraformaldehyde in 100 mM cacodylate buffer (pH 7.2) at 4°C for 4 hours .

    • Alternatively, use 4% paraformaldehyde for more sensitive epitopes.

  • Permeabilization and Blocking:

    • Permeabilize samples with 0.1% saponin in PBS containing 2% milk powder .

    • Block non-specific binding with the same solution for 30-60 minutes at room temperature.

  • Antibody Incubation:

    • Dilute rabbit anti-calnexin antibody 1:200 in PBS plus 2% milk powder and 0.1% saponin .

    • Incubate overnight at 4°C in a humidified chamber.

    • Wash 3-5 times with PBS.

    • Apply fluorescent secondary antibody (e.g., goat anti-rabbit Alexa) at 1:200 dilution in the same buffer .

    • Incubate for 1-2 hours at room temperature.

    • Wash thoroughly with PBS.

  • Imaging:

    • Use confocal microscopy with 60× objectives for optimal visualization of ER structures .

    • Consider z-stack imaging to fully capture the three-dimensional ER network.

    • Co-stain with other ER markers (e.g., BiP/GRP78) to confirm localization.

This protocol has been validated in studies of neuronal cells and can be adapted for different neuronal cell types with appropriate optimization .

How can researchers optimize Western blotting for detection of Rat Calnexin?

For optimal Western blot detection of rat calnexin, researchers should implement the following protocol:

  • Sample Preparation:

    • Lyse cells or tissues in buffer containing protease inhibitors.

    • Heat samples at 95°C for 5 minutes in reducing sample buffer.

    • Load 10-20 μg of total protein per lane depending on expression level.

  • Gel Electrophoresis:

    • Use 7.5% SDS-PAGE gels for optimal resolution of the 90 kDa calnexin protein .

    • Run alongside appropriate molecular weight markers.

  • Transfer and Blocking:

    • Transfer proteins to PVDF or nitrocellulose membrane.

    • Block with 5% non-fat milk or BSA in TBS-T for 1 hour at room temperature.

  • Antibody Incubation:

    • Incubate with primary anti-calnexin antibody at dilutions between 1:300-5000 or 1:1000 .

    • For monoclonal antibodies like the rabbit mAb C5C9, a 1:1000 dilution is typically optimal .

    • Incubate overnight at 4°C with gentle rocking.

    • Wash membrane thoroughly with TBS-T (3 × 10 minutes).

    • Incubate with appropriate HRP-conjugated secondary antibody.

    • Wash again thoroughly with TBS-T.

  • Detection:

    • Develop using enhanced chemiluminescence.

    • Expected band size is approximately 90 kDa .

    • If multiple bands appear, verify specificity with appropriate controls.

Including positive controls (such as HeLa cell lysate) can help validate the detection system . For quantitative analysis, researchers should implement appropriate normalization strategies using housekeeping proteins.

How does Calnexin deficiency affect neuronal systems and what are the implications for research?

Studies have revealed that calnexin deficiency leads to enhanced clathrin-dependent endocytosis in neuronal cells and in the mouse neuronal system . This finding has significant implications for researchers studying neuronal function, membrane trafficking, and synaptic transmission.

In calnexin-deficient mice, RT-PCR analysis of mRNA isolated from liver, brain, spinal cord, and cerebellum revealed altered expression patterns of proteins involved in endocytosis, particularly SGIP1 (SH3-domain GRB2-like endophilin-interacting protein 1) . Western blot analysis of protein extracts from wild-type and calnexin-deficient granule cells confirmed these changes at the protein level .

Electron microscopy analysis of cerebella from 7-day old mice demonstrated ultrastructural changes in synaptic morphology in the absence of calnexin . These findings suggest that calnexin plays a previously unrecognized role in regulating neuronal endocytosis, potentially through its interaction with endocytic machinery proteins like SGIP1.

Researchers investigating neuronal function should consider these findings when interpreting results from calnexin-deficient models or when manipulating calnexin expression in neuronal systems. The dual role of calnexin in ER quality control and endocytic regulation represents an important intersection between these cellular pathways.

What molecular interactions have been identified between Rat Calnexin and other neuronal proteins?

A key molecular interaction identified in rat neuronal systems is between the C-terminal cytoplasmic tail of calnexin and SGIP1, a neuronal regulator of endocytosis . This interaction was established through multiple experimental approaches:

  • Yeast Two-Hybrid Analysis:

    • The C-terminal tail of calnexin (C-tail, amino acids C504-E591) interacts with SGIP1 in yeast two-hybrid assays .

    • Specifically, the interaction involves the C-terminal Adap-Comp-Sub domain of SGIP1 .

    • Filter lift assays confirmed this interaction through reporter gene activation .

  • Tissue-Specific Expression:

    • RT-PCR analysis demonstrated SGIP1 expression in brain, spinal cord, and cerebellum of both wild-type and calnexin-deficient mice .

    • The mouse SGIP1 variant isolated from brain (826 amino acids) differs from previously reported rat SGIP1α and mouse SGIP1 variants .

    • Notable differences include the absence of amino acid residues G35-Q62 found in rat SGIP1α, suggesting species and possibly tissue-specific variations .

This interaction between calnexin and SGIP1 provides a molecular link between ER function and endocytic processes in neurons. Researchers studying neuronal protein trafficking should consider this interaction when investigating the role of calnexin in neuronal physiology and pathology.

What is the relationship between Calnexin and its homologue Calreticulin in immunological contexts?

Recent research has uncovered interesting relationships between calnexin and its homologue calreticulin, particularly regarding immune responses and autoantibody production. Analysis of sera from myeloproliferative neoplasm patients, multiple sclerosis patients, and healthy donors revealed that antibodies to both mutated calreticulin and calnexin are present at similar levels across these populations .

A high correlation between antibodies to mutated calreticulin and calnexin was observed in all patient and control groups, suggesting the presence of cross-reactive antibodies . Epitope binding studies indicated that these cross-reactive antibodies bound to a three-dimensional epitope encompassing a short linear sequence in the C-terminal regions of both mutated calreticulin and calnexin .

This finding has significant implications for both basic research and clinical investigations:

  • It suggests structural similarities between calnexin and mutated calreticulin that are recognized by the immune system.

  • The presence of these antibodies in healthy donors indicates that calreticulin mutations may be more common than previously thought and may not necessarily lead to disease onset .

  • The development of myeloproliferative neoplasms may require additional molecular changes beyond these mutations .

Researchers studying autoimmune responses or using these proteins as markers should be aware of this potential cross-reactivity and implement appropriate controls to distinguish between antibodies targeting each protein.

What are common technical challenges when working with Recombinant Rat Calnexin antibodies and how can they be addressed?

Researchers frequently encounter several technical challenges when working with recombinant rat calnexin antibodies. Here are solutions to the most common issues:

  • Non-specific Binding and Background:

    • Problem: High background staining in immunohistochemistry or immunofluorescence.

    • Solution: Optimize blocking conditions using 2% milk powder with 0.1% saponin . Increase washing steps and duration. Consider using different blocking agents (BSA, serum, or commercial blockers).

  • Variable Signal Intensity:

    • Problem: Inconsistent detection across experiments.

    • Solution: Use recombinant antibodies for superior lot-to-lot consistency . Standardize protein loading and normalize to housekeeping proteins. Store antibodies according to manufacturer recommendations (typically at -20°C with 50% glycerol) .

  • Cross-reactivity Issues:

    • Problem: Difficulty distinguishing between calnexin and its homologue calreticulin.

    • Solution: Select antibodies targeting unique epitopes not shared between proteins. Be aware that antibodies to mutated calreticulin may cross-react with calnexin due to structural similarities in their C-terminal regions .

  • Poor Signal in Fixed Tissues:

    • Problem: Weak or absent signal in formalin-fixed, paraffin-embedded tissues.

    • Solution: Optimize antigen retrieval methods. For calnexin, heat-induced epitope retrieval in citrate buffer (pH 6.0) is often effective. Adjust primary antibody concentration (try 1:200-400 for IHC-P) .

  • Suboptimal Western Blot Detection:

    • Problem: Weak bands or multiple non-specific bands.

    • Solution: Use 7.5% SDS-PAGE gels for optimal resolution of the 90 kDa protein . Optimize transfer conditions for high molecular weight proteins. Adjust antibody dilutions between 1:300-5000 depending on the specific antibody .

Implementing these troubleshooting strategies should significantly improve the reliability and reproducibility of experiments using recombinant rat calnexin antibodies.

How should researchers design appropriate controls for studies involving Rat Calnexin?

Designing appropriate controls is essential for rigorous research involving rat calnexin. Here are comprehensive control strategies for different experimental approaches:

  • Positive Controls:

    • Include samples known to express calnexin (e.g., HeLa cells for cross-reactive antibodies) .

    • For rat-specific studies, use rat tissue or cell line with verified calnexin expression.

    • When available, use recombinant calnexin protein as a standard for antibody validation.

  • Negative Controls:

    • Omit primary antibody while maintaining all other steps of the protocol.

    • Use calnexin-deficient cells or tissues when available .

    • For siRNA or shRNA knockdown studies, include scrambled RNA controls.

    • In immunoprecipitation experiments, include isotype-matched IgG controls.

  • Specificity Controls:

    • Pre-absorb antibody with recombinant calnexin to verify signal specificity.

    • Use multiple antibodies targeting different epitopes of calnexin to confirm findings.

    • Include closely related proteins (e.g., calreticulin) to assess potential cross-reactivity .

  • Technical Controls:

    • For Western blotting: Include molecular weight markers and loading controls.

    • For immunofluorescence: Include counterstains (e.g., DAPI for nuclei) and ER markers.

    • For RT-PCR: Include no-template controls and housekeeping genes (e.g., tubulin) .

  • Biological Controls:

    • Compare wild-type and calnexin-deficient models when studying functional aspects .

    • Include multiple cell types or tissues to assess tissue-specific variations.

    • For developmental studies, include samples from different time points.

Implementing these control strategies will strengthen the validity and reproducibility of results in calnexin research.

What role does Rat Calnexin play in neurodegenerative disease models?

Recent research suggests that rat calnexin may have significant implications for neurodegenerative disease models through its dual roles in ER quality control and neuronal endocytosis:

  • ER Stress and Protein Misfolding:
    Calnexin's primary function in quality control of glycoprotein folding places it at the center of cellular responses to misfolded proteins—a hallmark of many neurodegenerative diseases. As a chaperone that interacts with newly synthesized glycoproteins in the endoplasmic reticulum, calnexin helps prevent the accumulation of misfolded proteins that could contribute to neurodegeneration .

  • Endocytic Regulation:
    Studies have demonstrated that calnexin deficiency leads to enhanced clathrin-dependent endocytosis in neuronal cells . This finding establishes a link between calnexin and endocytic processes that are crucial for synaptic function and neuronal health. Altered endocytosis has been implicated in several neurodegenerative conditions, suggesting calnexin may influence disease progression through this mechanism.

  • Molecular Interactions:
    The interaction between calnexin's C-terminal tail and SGIP1, a neuronal regulator of endocytosis, provides a molecular mechanism linking ER function to synaptic processes . This connection may be particularly relevant in models of synaptic dysfunction and neurodegeneration.

  • Neuronal Calcium Homeostasis:
    As a calcium-binding protein, calnexin may contribute to neuronal calcium homeostasis . Dysregulation of calcium signaling is a common feature of neurodegenerative disorders, suggesting another potential mechanism for calnexin's involvement in these pathologies.

Future research should explore how alterations in calnexin expression or function might contribute to specific neurodegenerative disorders and whether targeting this protein could offer therapeutic opportunities.

How does post-translational modification of Calnexin affect its function in different research contexts?

Post-translational modifications (PTMs) of calnexin significantly influence its function across various research contexts, presenting important considerations for experimental design:

  • Phosphorylation:

    • The cytoplasmic C-terminal tail of calnexin contains multiple phosphorylation sites that may regulate its interactions with other proteins, including SGIP1 in neuronal systems .

    • Phosphorylation status may affect calnexin's role in quality control versus its participation in endocytic regulation.

    • When studying calnexin function, researchers should consider using phosphatase inhibitors during sample preparation to preserve physiologically relevant modification states.

  • Glycosylation:

    • While calnexin itself binds to glycosylated proteins, it may also undergo glycosylation that could affect its stability or interaction capabilities.

    • Different experimental models may exhibit varying patterns of calnexin glycosylation, potentially contributing to functional differences observed across species or cell types.

  • Calcium Binding:

    • As a calcium-binding protein, calnexin's conformation and function are sensitive to calcium levels .

    • Experimental conditions that alter calcium concentrations may significantly impact calnexin-dependent processes.

    • Researchers should carefully control calcium levels in buffers when conducting in vitro studies of calnexin function.

  • Oxidative Modifications:

    • The ER environment where calnexin resides is characterized by oxidative protein folding.

    • Oxidative stress can modify calnexin structure through mechanisms like disulfide bond formation or oxidation of specific residues.

    • Such modifications may alter calnexin's chaperone activity or its interactions with client proteins.

Understanding how these PTMs affect calnexin function is essential for interpreting experimental results and designing interventions targeting calnexin-dependent processes in research or therapeutic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.