Recombinant Rat Cannabinoid receptor 2 (Cnr2)
Shipped with Ice Packs 
In Stock 
Description
Production and Biochemical Properties
Recombinant Rat CB2 is typically expressed in prokaryotic systems (e.g., E. coli) with modifications for solubility and purification:
-
Expression tags: N-terminal His-tag for affinity chromatography .
-
Stability: Lyophilized powder stored at -20°C/-80°C to prevent degradation .
Primary Functions
-
Immune modulation: Regulates cytokine secretion in hematopoietic cells and macrophages .
-
Pain signaling: Interacts with endocannabinoids like 2-AG to modulate nociception .
-
Neuroprotection: Expressed in dopamine neurons, where it influences psychomotor behavior and alcohol reward pathways .
Research Applications
-
Binding assays: Studying interactions with agonists (e.g., JWH-015) or antagonists (e.g., SR144528) .
-
Signaling pathway analysis: Investigating G protein coupling (Gi/Go) and cAMP regulation .
-
Cancer research: Evaluating CB2’s role in suppressing EGF/EGFR or IGF-I/IGF-IR signaling in breast cancer .
Rat vs. Mouse CB2
| Aspect | Rat CB2 | Mouse CB2 |
|---|---|---|
| mRNA isoforms | CB2A, CB2B, CB2C, CB2D | CB2A, CB2B |
| Brain expression | Lower in DA neurons | Higher in DA neurons |
| Behavioral impact | Reduced locomotion | Enhanced psychomotor activity |
Functional Implications
-
CNS effects: Rat CB2’s lower expression in dopamine neurons may contribute to species differences in alcohol reward and anxiety-like behaviors .
-
Inflammatory responses: Rat CB2’s distinct mRNA isoforms (CB2C/D) may alter regional expression patterns during neuroinflammation .
Challenges and Limitations
-
Post-translational modifications: Absence of glycosylation in E. coli-expressed CB2 may affect receptor conformation .
-
Species extrapolation: Rat-specific isoforms (CB2C/D) complicate direct translation of findings to human or murine models .
-
Antibody specificity: Polyclonal antibodies (e.g., Bioss bs-2377R) may cross-react with melanocortin receptors in certain tissues .
Therapeutic Potential
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time
may vary based on the purchasing method or location. Please contact your local distributors
for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Cnr2; Cannabinoid receptor 2; CB-2; CB2; rCB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Uniprot No.
Target Background
Function
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. It is involved in inflammatory response, nociceptive transmission, and bone homeostasis.
Gene References Into Functions
- Research shows that this endogenous fatty acid ethanolamide affects cannabinoid signaling by upregulating cannabinoid receptor 2 expression in mononuclear phagocytic cells. PMID: 28336953
- CB2 receptor stimulation decreased P2Y13 receptor expression via p38MAPK/NF-kappaB signaling PMID: 28899427
- Findings suggest that endogenous cannabinoids may modulate the excitability and output of Retinal Ganglion Cells by differentially suppressing the activity of L- and T-type Calcium channels through activation of CB1Rs and CB2Rs. PMID: 28431968
- This study proposes that the promotion of microglial M2 polarization through the cAMP/PKA pathway participates in the cannabinoid receptor-2-mediated anti-inflammatory effects following germinal matrix hemorrhage induction. PMID: 27261088
- The study describes PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties. PMID: 27013280
- CB2Rs are functionally involved in several dopamine (DA)-related CNS disorders such as Parkinson's disease, depression, anxiety, and schizophrenia. PMID: 26833913
- CB2 may exhibit anti-fibrogenic effects after intraventricular hemorrhage. CB2 agonist suppressed fibrosis of the ventricular system and alleviated hydrocephalus following intraventricular hemorrhage, partly mediated by inhibiting TGF-beta1. PMID: 27769788
- Results indicate that CB2R activation partially prevents extracellular signal-regulated kinase phosphorylation, which attenuates microglia accumulation in in vitro and in vivo germinal matrix hemorrhage-induced brain injuries PMID: 25963415
- This research reveals a novel cellular function of CB2 cannabinoid receptors in the hippocampus and provides insights into how cannabinoid receptor subtypes diversify the roles of cannabinoids in the brain PMID: 25504573
- Targeting the CB2 receptor may represent a viable target for anti-inflammatory disease modification in Parkinson's disease PMID: 25895887
- The results suggested that activating the CB2 receptor exerted protective activity against PQ-induced ALI, and it potentially contributed to the suppression of the activation of MAPKs and NF-kappaB pathways. PMID: 24963491
- Data suggest that ligand binding to Cnr2 in the spleen is crucial for agonist action (and presumably antinociceptive action) of ligands (despite low signal obtained in native tissues). PMID: 23711022
- CB2 receptors exhibit postsynaptic inhibitory effects on urinary bladder contraction PMID: 23081739
- The activation of the CB2 receptor inhibits the intrinsic, mitochondria-mediated apoptotic pathway through activation of the PI3k/Akt signaling pathway. PMID: 23711495
- The study investigated the bilateral distribution of the CB2R protein and messenger RNA (mRNA) in rat dorsal root ganglia (DRG) after unilateral peripheral nerve injury PMID: 23657829
- cnr2 activation reverses amyloid-induced memory deficits, decreases microglial and astrocyte markers, promotes amyloid clearance, decreases cnr2 upsurge, and reduces IL1beta secretion. PMID: 22795792
- Data indicate that chronic activation of CB2 (but not CB1) in neurons of the prefrontal cortex enhances expression of serotonin 2A receptor (5-HT2A) and dopamine D2 receptor (D2 receptor) and the formation of 5-HT2A/D2 receptor complexes. PMID: 22791651
- The cannabinoid 2 receptor plays a significant role in the development of bone cancer pain. PMID: 22490961
- Regarding the signaling pathways of CB2/nNOS-mediated neuroprotection, the study demonstrated nNOS-dependent modulation of the expression of anti-oxidative (Hsp70) and anti-apoptotic (Bcl-2) proteins. PMID: 22198001
- CB(2)Rs are located intracellularly in layer II/III pyramidal cells of the rodent medial prefrontal cortex. Their activation results in IP(3)R-dependent opening of Ca(2+)-activated Cl(-) channels. PMID: 22331871
- CB2 receptors contribute to the delayed neuroprotective effect, while CB1 receptor mediates the rapid ischemic tolerance induced by electroacupuncture pretreatment against focal cerebral ischemia. PMID: 21443454
- Data indicate that MDMA produces changes in IL-1 signal modulators which are modified by CB2 receptor activation, suggesting that IL-1beta may play a partial role in MDMA-induced neurotoxicity. PMID: 21595923
- Brain CB2 receptors do not appear to mediate the hypothermic response to bacterial lipopolysaccharide. PMID: 21486787
- The study revealed that the CB2 receptor is localized in retinal pigmentary epithelium, inner photoreceptor segments, horizontal and amacrine cells, cells located in the ganglion cell layer, and in fibers of the inner plexiform layer. PMID: 20803619
- This finding provides new evidence showing the potential role of CB2 receptors in the analgesic effect of acupuncture on inflammatory pain. PMID: 20627823
- The study examined the ovary for the presence of CB(1) and CB(2) receptors and fatty acid amide hydrolase. In preantral and antral follicles, CB(2) receptor was detected only in oocytes; in functional corpus luteum, it was detected in the luteal cells. PMID: 20665820
- CBR2 receptors mediate anandamide-induced inhibitory action on the activation of hepatic stellate cells. PMID: 18578993
- Levels of the cannabinoid receptor type 2 in cells of macrophage lineage undergo major modulatory changes in relation to cell activation. PMID: 11789671
- The rat peripheral cannabinoid receptor (rCB2) was cloned from a Sprague-Dawley rat spleen cDNA library and, when translated, encodes a protein of 410 amino acids. PMID: 12084572
- Induction of CB2 receptor expression in the rat spinal cord of neuropathic but not inflammatory chronic pain models. PMID: 12823482
- This review discusses the possibility that CB2 receptors in the rat intestine could contribute to reducing the increase of intestinal motility induced by an endotoxic inflammation. PMID: 15277313
- Activation of cannabinoid CB2 receptors is sufficient to suppress neuronal activity at central levels of processing in the spinal dorsal horn. PMID: 15317842
- This study demonstrates that activation of peripheral CB2 receptors attenuates both innocuous- and noxious-evoked responses of WDR neurons in models of acute, inflammatory, and neuropathic pain. PMID: 15525273
- Cannabinoids abrogate microglia-mediated neurotoxicity after betaA addition to rat cortical cocultures, indicating a role for cannabinoid receptors in preventing neurodegeneration. CB2 receptors appear to be exclusively expressed by microglia. PMID: 15728830
- Our results suggest that the role of CB2 receptors in the brain may have been previously underestimated. PMID: 16356641
- The multifocal expression of CB2 immunoreactivity in glial and neuronal patterns in a number of brain regions suggests a reevaluation of the possible roles that CB2 receptors may play in the brain. PMID: 16472786
- Involvement of the cyclic AMP-protein kinase A-Cyclic AMP response element pathway in the regulation of CB(2) receptor levels. PMID: 17045344
- CB2 cannabinoid receptors and their gene transcripts are widely distributed in the brain and may play broader roles. PMID: 17356307
- The endocannabinoid system modulates glucose homeostasis through the coordinated actions of cannabinoid CB1 and CB2 receptors. PMID: 17499236
- The results of this study suggest that endogenous cannabinoids, through acting on cannabinoid CB(2) receptors, are involved in the cardioprotective phenomenon of remote ischemic preconditioning, induced by mesenteric artery occlusion and reperfusion. PMID: 17950273
- We conclude that WIN inhibits the neurotransmission in the NTS of young rats via a receptor distinct from CB1 or CB2. PMID: 18308297
- It was concluded that activation of CB2 receptors in the enteric nervous system dampens endotoxin-induced enhanced intestinal contractility. PMID: 18483180
- Subcellular distribution of CB2 cannabinoid receptors is demonstrated in neuronal, glial, and endothelial cells in rat hippocampus with immunohistochemical electron microscopy. PMID: 18798269
- Data demonstrate the functional expression of CB2 receptors in the brain that may provide novel targets for the effects of cannabinoids in depression and substance abuse disorders beyond neuroimmunocannabinoid activity. PMID: 18991891
- Results provide ultrastructural evidence that CB2 receptors are mainly postsynaptic in the CA1 area of the hippocampus and substantia nigra. PMID: 18991892
- CB2R activation counteracts apoptotic cell death that is induced by remote axonal damage by acting through phosphatidylinositol 3-kinase/Akt signaling. PMID: 19357281
- Cellular microglial pathway triggered by CBR2 activation; reduction of pro-inflammatory factors and microglial migration via MKP-3 induction is part of the mechanism of action of CBR2 agonists. PMID: 19476641
- To date, it has been thought that cannabinoid receptors in the CNS are primarily of the CB1R subtype, with CB2R expressed only in glia and peripheral tissues. However, these data provide pharmacological evidence for functional CB2R at CNS synapses. PMID: 19616018
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon. Note=Localizes to apical dendrite of pyramidal neurons.
Tissue Specificity
Expressed in spleen and brain by neurons and glial cells (at protein level). Expressed in lung, testis and thymus but not in heart, liver or kidney. Expressed in cerebellum, cortex and brainstem.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
