Recombinant Rat Cardiolipin synthase (Crls1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing the order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Crls1; Cardiolipin synthase; CMP-forming; CLS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Crls1
Target Protein Sequence
MLAWRVARGAWGSLRVAVRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGTSPRTHCSGAGKAAPEPAAGGDAAAQAPSARWVRASATSSYENPWTIPNLLSMTRIGL APVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISIL YISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTF ISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIK GK
Uniprot No.

Target Background

Function
Cardiolipin synthase catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a crucial phospholipid found in mitochondrial membranes and plays vital roles in maintaining mitochondrial functional integrity and dynamics under both optimal and stressful conditions.
Gene References Into Functions
  1. Knock-down of cardiolipin synthase affected the cellular CL content in the presence of linoleic acid (LA) in the culture medium. PMID: 29325722
  2. CL plays important roles in neuronal signaling, mitochondrial bioenergetics, and apoptosis. PMID: 18454555
Database Links
Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Rat Cardiolipin synthase (Crls1) and what is its function in mitochondrial biology?

Cardiolipin synthase (Crls1) is an essential enzyme that catalyzes the final step in cardiolipin biosynthesis. It specifically transfers a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), forming cardiolipin (CL), a unique phospholipid predominantly found in the inner mitochondrial membrane . Cardiolipin plays critical roles in:

  • Maintaining mitochondrial membrane structure and integrity

  • Supporting optimal function of respiratory chain complexes

  • Regulating mitochondrial dynamics and morphology

  • Stabilizing protein complexes within the inner mitochondrial membrane

  • Supporting energy metabolism through oxidative phosphorylation

Rat Crls1 (UniProt ID: Q5U2V5) is functionally similar to human CLS1, with both enzymes exclusively localized to mitochondria and catalyzing the same biochemical reaction .

Several methodological approaches can be employed to detect and measure Crls1 activity:

  • Enzyme activity assays:

    • Measuring formation of non-natural CL species (e.g., CL14:0/14:0/18:1/18:1) during tissue incubation with appropriate substrates

    • Incubation with radiolabeled substrates such as [14C]PG and CDP-DAG, followed by lipid extraction and TLC separation

  • Protein detection methods:

    • ELISA-based quantification in serum, plasma, or cell lysates

    • Western blotting with specific antibodies

    • Immunohistochemistry for localization studies

  • Lipidomics approaches:

    • LC-MS/MS analysis of cardiolipin species

    • Quantification of cardiolipin content in mitochondrial fractions

    • Monitoring incorporation of labeled precursors into cardiolipin

  • Molecular techniques:

    • Quantitative PCR for gene expression analysis

    • RNA interference to study loss-of-function effects

    • Recombinant expression systems for structure-function studies

How can recombinant Crls1 expression systems be optimized for enzymatic characterization?

Optimizing recombinant Crls1 expression requires careful consideration of several factors:

  • Expression system selection:

    • Mammalian cells (e.g., COS-7) provide native post-translational modifications and cellular environment

    • Yeast complementation systems allow functional studies in crd1Δ strains lacking endogenous CLS activity

    • Bacterial systems offer high yield but may lack proper folding for mitochondrial proteins

  • Construct design optimization:

    • Include proper mitochondrial targeting sequences for correct localization

    • Consider epitope tags that don't interfere with enzymatic activity

    • Use codon optimization for the expression system of choice

  • Activity measurement considerations:

    • Ensure availability of both substrates (CDP-DAG and PG) in reaction mixtures

    • Consider the enzyme's alkaline pH optimum and requirement for divalent cations

    • Control for endogenous phosphatidylglycerophosphate synthase (PGS) activity that might affect substrate availability

  • Validation methods:

    • Compare activity in intact cells versus isolated mitochondria

    • Confirm mitochondrial localization through subcellular fractionation and immunohistochemistry

    • Include catalytically inactive mutants (e.g., D116A in C. elegans Crls1) as negative controls

Research has shown that recombinant Crls1 expressed in COS-7 cells catalyzes efficient synthesis of cardiolipin only when both CDP-DAG and PG are present, confirming the specificity of the enzymatic reaction .

What are the consequences of Crls1 deficiency on mitochondrial structure and function?

Crls1 deficiency has profound effects on mitochondrial biology, though these effects can vary between tissues and cell types:

  • Structural abnormalities:

    • Smaller, rounder mitochondria with contracted appearance

    • Highly disordered cristae morphology with large areas devoid of cristae

    • Impaired cristae folding similar to defects found in Barth syndrome patients

  • Functional consequences:

    • Decreased membrane potential

    • Impaired oxidative phosphorylation

    • Defective respiratory electron transport chain activity

    • Increased reliance on glycolysis for ATP production

  • Tissue-specific manifestations:

    • Cardiomyocyte-specific Crls1 knockout in mice leads to dilated cardiomyopathy

    • In C. elegans, cardiolipin depletion selectively affects germ cell proliferation and mitochondrial function

    • In humans, biallelic CRLS1 variants can cause progressive mitochondrial encephalopathy

The differential sensitivity of tissues to Crls1 deficiency provides insight into the varying importance of cardiolipin across different cell types in vivo .

How do fatty acid metabolism enzymes interact with cardiolipin synthesis pathways?

The interplay between fatty acid metabolism and cardiolipin synthesis represents an important area of investigation:

  • ACSL1 contribution to cardiolipin composition:

    • Acyl-CoA synthetase 1 (ACSL1) exhibits strong substrate preference for linoleate

    • ACSL1 deficiency results in 83% reduction in tetralinoleoyl-cardiolipin in heart tissue

    • ACSL1 knockdown leads to reduced incorporation of linoleate into cardiolipin

  • Remodeling pathways:

    • Initially synthesized cardiolipin undergoes remodeling to achieve tissue-specific fatty acid compositions

    • Monolysocardiolipin acyltransferase (MLCL-AT) is a rate-limiting enzyme in cardiolipin remodeling

    • MLCL-AT preferentially incorporates linoleoyl-CoA, contributing to the high prevalence of unsaturated fatty acyl species in mature cardiolipin

  • Alternative synthesis pathways:

    • In addition to the classical mitochondrial pathway, an alternative cardiolipin biosynthetic pathway involves acylation of lysophospholipids in the endoplasmic reticulum

    • Two acyltransferases have been identified: lysophosphatidylglycerol acyltransferase (LPGAT1) and acyl-CoA:lysocardiolipin acyltransferase (ALCAT1)

This complex interplay highlights the importance of studying Crls1 in the broader context of mitochondrial phospholipid metabolism rather than in isolation.

What methods can be used to study cardiolipin turnover in relation to Crls1 activity?

Studying cardiolipin turnover requires sophisticated methodological approaches:

  • Isotope labeling techniques:

    • Incorporation of [14C]linoleic acid to trace newly synthesized cardiolipin

    • Use of 13C3-glycerol-3-phosphate to follow glycerol backbone incorporation

    • Determination of turnover rate constants from serial fractional synthesis measurements using the equation qt = 1−e−kt

  • Mass spectrometry approaches:

    • LC-MS/MS analysis of cardiolipin species

    • Monitoring isotopomer distributions to distinguish newly synthesized from existing molecules

    • Calculation of half-life times as t1/2 = ln2/k

  • In vitro enzyme assays:

    • Creation of non-natural cardiolipin species (e.g., CL14:0/14:0/18:1/18:1) as traceable markers

    • Quantification of specific CL species formed during incubation

    • Expression of enzyme activities as fmol CL formed per minute and μg protein

  • Whole cell labeling experiments:

    • Culturing cells with radiolabeled precursors (e.g., [14C]oleoyl-CoA)

    • Extraction of total lipids and analysis by thin-layer chromatography (TLC)

    • Quantification of labeled cardiolipin in proportion to expression levels

These techniques provide valuable insights into both the synthesis and remodeling aspects of cardiolipin metabolism.

What are the established assays for measuring recombinant Crls1 enzymatic activity?

Several assay systems have been developed to measure Crls1 activity:

  • Radioactive substrate incorporation assay:

    • Incubation of enzyme with CDP-DAG and [14C]PG

    • Extraction of lipids and separation by thin-layer chromatography

    • Quantification of radioactivity incorporated into cardiolipin

  • Coupled enzyme assay system:

    • Using LPGAT1 to produce [14C]PG from [14C]lysophosphatidylglycerol

    • Adding recombinant Crls1 and CDP-DAG to the reaction

    • Measuring formation of [14C]cardiolipin as the final product

  • Non-natural cardiolipin species formation:

    • Incubation of tissue homogenates with specific substrates

    • Monitoring formation of CL14:0/14:0/18:1/18:1 by LC-MS/MS

    • Quantification against internal standards (CL14:1/14:1/14:1/15:1, CL15:0/15:0/15:0/16:1)

  • Intact cell labeling:

    • Transfection of cells with Crls1 expression constructs

    • Culture with [14C]oleoyl-CoA to label newly synthesized lipids

    • Extraction and analysis of total lipids by TLC

When establishing these assays, it's important to include appropriate controls such as:

  • Cells transfected with empty vectors

  • Reactions missing one substrate

  • Heat-inactivated enzyme preparations

How do mutations in Crls1 affect cardiolipin biosynthesis and contribute to disease pathology?

Mutations in Crls1 have significant consequences for cardiolipin biosynthesis and cellular function:

  • Human disease-associated mutations:

    • Biallelic variants in CRLS1 lead to cardiolipin deficiency and progressive mitochondrial encephalopathy

    • The p.(Ile109Asn) variant impairs CL-associated regulation of mitochondrial membranes

  • Experimental mutations in model systems:

    • D116A mutation in C. elegans CRLS-1 abolishes enzymatic activity

    • This approach allows creation of catalytically inactive controls for rescue experiments

  • Cellular consequences:

    • Mitochondrial morphological abnormalities (smaller, rounder mitochondria)

    • Disordered cristae architecture

    • Impaired oxidative phosphorylation

  • Tissue-specific pathology:

    • Cardiomyocyte-specific Crls1 knockout in mice results in dilated cardiomyopathy

    • Different tissues show varying sensitivity to cardiolipin deficiency

Understanding the molecular basis of these pathologies provides important insights into the role of cardiolipin in mitochondrial function and the potential for therapeutic interventions.

What transgenic and knockout models are available for studying Crls1 function?

Several genetic models have been developed to study Crls1 function:

  • Mouse models:

    • Cardiomyocyte-restricted Crls1 knockout using Myh6-Cre driver (Myh6-Cre/+; Crls1flox/flox)

    • These mice develop dilated cardiomyopathy in infancy

  • C. elegans models:

    • crls-1(tm2542) deletion mutants

    • Transgenic rescue with heat-shock-inducible constructs (hsp::crls-1)

    • RNAi knockdown using feeding of double-stranded RNA

  • Yeast models:

    • crd1Δ yeast lacking endogenous cardiolipin synthase

    • Complementation with human or rat CLS1 genes

    • Useful for structure-function studies of conserved enzyme features

  • Cell culture models:

    • Stable knockdown of ACSL1 in H9c2 rat cardiomyocytes

    • Overexpression systems in various cell types (COS-7, HEK-293)

    • CRISPR/Cas9-mediated targeted mutations

Each model system offers unique advantages for investigating specific aspects of Crls1 biology, from biochemical mechanisms to physiological consequences.

How can lipidomics approaches be applied to study Crls1 activity and cardiolipin metabolism?

Lipidomics provides powerful tools for analyzing cardiolipin metabolism:

  • Sample preparation protocols:

    • Extraction of lipids from tissues containing approximately 1 mg cardiac protein

    • Chloroform/methanol extraction following Bligh & Dyer method

    • Preparation for mass spectrometry analysis

  • Analytical techniques:

    • LC-MS/MS analysis for cardiolipin species identification

    • Monitoring isotopomer distributions for turnover studies

    • Quantification against internal standards

  • Data processing approaches:

    • Processing lipid mass spectra in software such as Xcalibur

    • Selection of lipid species with favorable signal-to-noise ratios

    • Analysis of both light isotopomers (monoisotopic peak) and heavy isotopomers (13C3 peak)

  • Turnover calculations:

    • Determination of turnover rate constants using non-linear regression

    • Calculation of half-life times

    • Analysis of multiple isotopomers for complex lipids like PG and CL

These approaches enable comprehensive characterization of cardiolipin metabolism in different experimental contexts, providing insights into both synthetic and remodeling pathways.

What considerations are important when designing inhibition or activation studies targeting Crls1?

When designing studies to modulate Crls1 activity, several factors should be considered:

  • Enzyme characteristics:

    • Alkaline pH optimum

    • Requirement for divalent cations

    • Different substrate preferences for CDP-diacylglycerol species compared to phosphatidylglycerol species

  • Experimental approach selection:

    • Genetic manipulation (knockout, knockdown, overexpression)

    • Small molecule inhibitors/activators

    • Substrate availability modulation

  • Control considerations:

    • Monitor effects on related pathways (e.g., phosphatidylglycerophosphate synthase)

    • Include catalytically inactive mutants as negative controls

    • Verify mitochondrial localization of recombinant proteins

  • Outcome measurements:

    • Direct enzyme activity assays

    • Cardiolipin content and species distribution

    • Mitochondrial morphology and function

    • Cellular/organismal phenotypes

Careful experimental design will enable more precise understanding of Crls1's role in normal physiology and disease states.

What are the key technical challenges in purifying active recombinant Crls1?

Purification of active recombinant Crls1 presents several technical challenges:

  • Expression system limitations:

    • As a mitochondrial membrane protein, Crls1 requires appropriate membrane environment

    • Maintaining proper folding during expression and purification

    • Need for post-translational modifications

  • Purification considerations:

    • Requirement for detergents or nanodiscs to maintain membrane protein structure

    • Potential loss of activity during extraction from membranes

    • Need for rapid processing to prevent degradation

  • Activity preservation:

    • Maintaining the alkaline pH optimum during purification steps

    • Inclusion of appropriate divalent cations

    • Preventing oxidation of critical residues

  • Validation approaches:

    • Verification of activity using both substrates (CDP-DAG and PG)

    • Comparison with enzyme activity in intact mitochondria

    • Analysis of substrate specificity for different CDP-DAG and PG species

Many studies utilize membrane preparations or whole cells expressing recombinant enzyme rather than purified protein due to these challenges .

How can researchers distinguish between de novo cardiolipin synthesis and remodeling pathways?

Distinguishing between de novo synthesis and remodeling of cardiolipin requires sophisticated experimental approaches:

  • Pulse-chase labeling:

    • Initial labeling with precursors specific to synthesis pathway

    • Monitoring incorporation into newly synthesized cardiolipin

    • Following redistribution of label during remodeling phase

  • Specific enzyme inhibition/knockout:

    • Targeted inhibition of Crls1 (synthesis) versus MLCL-AT (remodeling)

    • Analysis of cardiolipin species changes under each condition

    • Dual inhibition to understand pathway interdependence

  • Molecular species analysis:

    • Newly synthesized cardiolipin typically has a different fatty acid composition

    • Remodeled cardiolipin is enriched in specific fatty acids (e.g., linoleic acid)

    • Mass spectrometry can distinguish these molecular species

  • Combined approaches:

    • Analysis of both total cardiolipin content and molecular species distribution

    • Measurement of precursor incorporation rates

    • Determination of turnover rate constants for different molecular species

Understanding the interplay between synthesis and remodeling pathways is critical for comprehensive analysis of cardiolipin metabolism.

What emerging technologies might advance our understanding of Crls1 function?

Several emerging technologies hold promise for advancing Crls1 research:

  • Cryo-electron microscopy:

    • Structural determination of Crls1 at atomic resolution

    • Visualization of enzyme-substrate complexes

    • Understanding conformational changes during catalysis

  • CRISPR/Cas9 genome editing:

    • Creation of precise disease-relevant mutations

    • Tissue-specific and inducible knockout models

    • High-throughput screening for genetic interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy of mitochondrial membrane dynamics

    • Live-cell imaging of cardiolipin distribution using specific probes

    • Correlative light and electron microscopy of mitochondrial structure

  • Single-cell lipidomics:

    • Analysis of cell-to-cell variation in cardiolipin content and composition

    • Correlation with mitochondrial function at the single-cell level

    • Investigation of heterogeneity within tissues

These technologies will provide unprecedented insights into the structural biology, regulation, and physiological functions of Crls1.

What are the therapeutic implications of modulating Crls1 activity in mitochondrial disorders?

Modulating Crls1 activity holds potential therapeutic implications:

  • Disease targets:

    • Primary defects in CRLS1 causing mitochondrial encephalopathy

    • Secondary cardiolipin deficiency in conditions like Barth syndrome

    • Mitochondrial dysfunction in neurodegenerative diseases

  • Therapeutic strategies:

    • Gene therapy approaches to restore CRLS1 function

    • Small molecule activators of Crls1 enzymatic activity

    • Substrate supplementation to enhance cardiolipin synthesis

  • Delivery challenges:

    • Targeting therapeutics to mitochondria

    • Tissue-specific delivery systems

    • Crossing the blood-brain barrier for neurological disorders

  • Outcome measurements:

    • Restoration of cardiolipin content and composition

    • Improvement in mitochondrial morphology and function

    • Clinical endpoints specific to target disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.