Recombinant Rat Carnitine O-palmitoyltransferase 1, liver isoform (Cpt1a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cpt1a; Cpt-1; Cpt1; Carnitine O-palmitoyltransferase 1, liver isoform; CPT1-L; Carnitine O-palmitoyltransferase I, liver isoform; CPT I; CPTI-L; Carnitine palmitoyltransferase 1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-773
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
AEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPSS WLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIMT MRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVKD TVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIY LRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGSTI PLCSAQWERLFNTSRIPGEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQ QMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLD ESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPVV GHLWEYVMATDVFQLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLLA NDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGR TETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCLY VVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGYG VSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTINSKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the acyl group from long-chain fatty acid-CoA conjugates to carnitine. This is a crucial step for mitochondrial uptake of long-chain fatty acids and their subsequent β-oxidation. It plays a significant role in hepatic triglyceride metabolism.
Gene References Into Functions

Relevant Literature: The following publications highlight the functional role of Carnitine Palmitoyltransferase 1 (CPT1):

  1. Obesity-alleviating potential of asiatic acid and its effects on ACC1, UCP2, and CPT1 mRNA expression in high-fat diet-induced obese Sprague-Dawley rats. PMID: 28993954
  2. Analysis of Cpt1b expression in white adipose tissue and its relationship to obesity phenotype. PMID: 28330968
  3. The impact of CPT1AM expression on fatty acid oxidation, lipolysis, and lipid-induced metabolic derangements. PMID: 27438137
  4. The role of CPT1 expression in reducing lipid intermediate accumulation in skeletal muscle. PMID: 23815800
  5. The relationship between CPT-1 activity and fasting/refeeding states, suggesting a physiological role in feeding control. PMID: 23736540
  6. The impact of L-CPT1 expression on metabolic remodeling and hypertrophic signaling in the heart. PMID: 22982985
  7. The hypolipidemic effect of donkey's milk and its correlation with mitochondrial activity and expression of carnitine palmitoyltransferase and uncoupling protein 2. PMID: 22930490
  8. The effect of L-carnitine supplementation on age-related decline in carnitine palmitoyltransferase 1 (CPT1) activity in rat heart mitochondria. PMID: 22322067
  9. Investigation of the sequence-dependence of oligomerization of transmembrane domain 2 of CPT1A and its role in enzyme function. PMID: 21917985
  10. An environment-dependent structural switch underlying the regulation of carnitine palmitoyltransferase 1A. PMID: 21990363
  11. Study of modifications to carnitine palmitoyltransferase-I (CPT-I) during steatohepatitis. PMID: 21909411
  12. Interaction of acyl-CoA binding proteins with the acyl-CoA binding domain of mitochondrial carnitine palmitoyltransferase I. PMID: 21541677
  13. Protein-protein interaction between CPT1a, long-chain acyl-CoA synthetase, and voltage-dependent anion channel. PMID: 21622568
  14. Differences in malonyl-CoA sensitivity between pig and rat L-CPTI, attributed to differences in N-terminal amino acid residue interactions. PMID: 11790778
  15. Effects of adenovirus-mediated overexpression of liver carnitine palmitoyltransferase I on INS1E cell metabolism and insulin secretion. PMID: 11988095
  16. The role of the C-terminal 31 residues in the initial protein folding of L-CPTI. PMID: 12351641
  17. Localization of L-CPT1 and its relationship to malonyl-CoA chloramphenicol acetyltransferase in microsomal fractions. PMID: 12401113
  18. Conserved residues in rat liver carnitine palmitoyltransferase essential for malonyl-CoA inhibition. PMID: 12499375
  19. Identification of conserved arginine and glutamate residues in the C-terminal domain important for catalytic activity and malonyl-CoA sensitivity. PMID: 12540837
  20. The impact of hypothalamic carnitine palmitoyltransferase-1 activity inhibition on food intake and endogenous glucose production. PMID: 12754501
  21. Similar malonyl-CoA sensitivity of rat liver and muscle carnitine palmitoyltransferase I isoforms, attributed to a single amino acid in the C-terminal domain. PMID: 12826662
  22. A structural model for L-CPT I (liver CPT I), based on its similarity to mouse carnitine acetyltransferase. PMID: 14711372
  23. Kinetic study of rat liver mitochondrial carnitine palmitoyltransferase-I. PMID: 15247243
  24. mRNA steady-state levels of CPT I and mit HMG-CoA in rat DMBA-induced mammary cancer. PMID: 15254779
  25. The role of peroxisome proliferator-activated receptor-gamma coactivator-1(PGC-1)alpha in thyroid hormone stimulation of Carnitine palmitoyltransferase I (CPT-I) alpha gene expression. PMID: 15469941
  26. Regulation of L-CPT I transcription by long-chain fatty acids through a PPARalpha-independent pathway. PMID: 16177188
  27. The role of the loop-transmembrane (TM)2 boundary sequence in determining the membrane disposition of TM2 and its influence on malonyl-CoA interaction. PMID: 16908527
  28. The protective effect of LCPT I overexpression against fatty acid-induced insulin resistance in L6E9 myotubes. PMID: 17062841
  29. PGC-1beta as a coactivator in T3 induction of CPT-Ialpha, highlighting similarities and differences with PGC-1alpha. PMID: 17239528
  30. The potential role of the oligomeric structure of CPT1A in substrate channeling. PMID: 17650509
  31. The potential benefits of interventions increasing CPT1a activity in the treatment of nonalcoholic fatty liver disease. PMID: 18349115
  32. The potential contribution of accumulated 3-hydroxylated long-chain fatty acid intermediates to retinopathy in MTP deficiencies. PMID: 18385088
  33. The beneficial effects of regulated CPT1 overexpression in glucolipotoxic beta-cells. PMID: 18706397
  34. The impact of a high-fat diet on insulin resistance and the beneficial effects of CPT1 overexpression in rat muscle. PMID: 19073774
  35. Molecular modeling of rCPT1A TM2 and the role of GXXXG and GXXXA motifs in TM2 hexamer formation. PMID: 19136561
  36. CPT1A as a target for increasing hepatic LCFA beta-oxidation and the potential of modulating malonyl-CoA sensitivity in preventing/correcting hepatic steatosis. PMID: 19302064
Database Links

KEGG: rno:25757

STRING: 10116.ENSRNOP00000019652

UniGene: Rn.2856

Protein Families
Carnitine/choline acetyltransferase family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Liver and kidney.

Q&A

What is the functional role of CPT1A in cellular metabolism?

CPT1A is the rate-limiting enzyme in the carnitine palmitoyltransferase system, responsible for facilitating the transfer of long-chain fatty acids from the cytosol into the mitochondrial matrix for β-oxidation. It catalyzes the conversion of long-chain acyl-CoA to acylcarnitine, which can then be transported across the inner mitochondrial membrane by carnitine-acylcarnitine translocase. This process is essential for energy production from fatty acids, particularly during fasting or high energy demand states .

Methodological approach: To study CPT1A's role in metabolism, researchers typically employ enzyme activity assays using spectrophotometric detection of CoA released during the enzymatic reaction with DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)). This provides a reliable proxy for enzyme activity based on the direct relationship between CPT1A catalytic activity and increasing CoA concentration .

How is CPT1A structurally organized, particularly its transmembrane domains?

CPT1A is anchored to the outer mitochondrial membrane through two transmembrane domains, with both the N-terminus and the catalytic C-terminus facing the cytosol. Transmembrane domain 2 (TM2) has been particularly studied for its role in oligomerization through GXXXG(A) motifs, which affects the enzyme's sensitivity to malonyl-CoA inhibition .

Methodological approach: To investigate the structure-function relationship of CPT1A's transmembrane domains, researchers can use complementary genetic assays that facilitate measurement of helix-helix interactions in the Escherichia coli inner membrane, combined with multiple quantitative biophysical methods .

What experimental systems are most suitable for studying rat CPT1A?

Several experimental systems have proven effective for studying rat CPT1A:

  • In vitro expression systems: E. coli for expressing catalytic domains (Leu572~Lys773) with N-terminal His and GST tags .

  • Yeast expression: Pichia pastoris for full-length enzyme expression with appropriate post-translational modifications .

  • Mammalian cell systems: Expi293 cells transfected with CPT1A plasmid for reliable and robust source of catalytically active human CPT1A .

  • Animal models: Cardiac-specific CPT1A knockout mice and AAV9-mediated cardiac-specific CPT1A overexpression for in vivo studies .

  • Primary cell cultures: Isolated hepatocytes for glucose production studies .

Methodological recommendation: For optimal protein expression, direct transfection of mammalian cells (such as Expi293) with a CPT1A plasmid has been demonstrated to provide reliable enzyme activity for high-throughput screening applications .

What methods are most effective for detecting and quantifying CPT1A?

Researchers employ several complementary approaches to detect and quantify CPT1A:

  • Immunodetection: ELISA using specific anti-CPT1A monoclonal antibodies with sensitivity reaching 9.375 pg/ml .

  • Protein analysis: Western blotting for protein expression levels in tissue or cell samples .

  • Transcriptional analysis: RT-qPCR for mRNA expression evaluation, which shows variable correlation with protein levels depending on the tissue context .

  • Activity assays: Spectrophotometric detection of CoA using DTNB or radioisotope-based assays using 3H-carnitine (though the latter has safety limitations) .

Methodological insight: The ELISA approach allows detection of CPT1A in the transfected cell pellet with approximately 13-fold higher sensitivity compared to control cell pellets, while minimal CPT1A is detected in the supernatant, confirming its tight association with mitochondrial membranes .

How does oligomerization of transmembrane domains affect CPT1A function and malonyl-CoA sensitivity?

The oligomerization state of CPT1A, particularly mediated by transmembrane domain 2 (TM2), significantly impacts the enzyme's sensitivity to malonyl-CoA inhibition. Research has shown that TM2 can form oligomers (up to hexamers) through close-packing of GXXXG(A) motifs .

Experimental evidence demonstrates that disruption of these GXXXG(A) motifs reduces the oligomeric state to trimers or lower, which correlates with increased sensitivity to malonyl-CoA inhibition. Specifically, the IC50 decreases from 30.3 ± 5.0 to 3.0 ± 0.6 μM when these motifs are disrupted .

Methodological approach: To study this phenomenon, researchers can employ mutations designed to disrupt close-packing of the GXXXG(A) motifs in TM2 peptides and analyze changes in the oligomeric state using complementary genetic assays and biophysical methods. These changes can then be correlated with functional effects on malonyl-CoA sensitivity in the full-length enzyme .

What are the methodological approaches for expressing recombinant rat CPT1A with optimal enzymatic activity?

Expressing functionally active recombinant rat CPT1A requires consideration of several technical factors:

  • Expression system selection:

    • E. coli: Suitable for producing the catalytic domain (e.g., Leu572~Lys773) with N-terminal His and GST tags .

    • Yeast (Pichia pastoris): Effective for expressing full-length enzyme with post-translational modifications .

    • Mammalian cells (Expi293): Provides human-like post-translational modifications and proper folding .

  • Optimization strategies:

    • Direct transfection of mammalian cells with CPT1A plasmid

    • Use of appropriate cell lysis procedures that maintain enzyme activity

    • Appropriate buffer composition: PBS (pH 7.4) containing 0.01% SKL, 5% Trehalose .

  • Activity validation:

    • Spectrophotometric DTNB-based detection of free thiols

    • Testing with known inhibitors (etomoxir, perhexiline, chlorpromazine) .

For high-throughput applications, the direct cell lysis of human CPT1A-transformed Expi293 cells without the need for purification of recombinant proteins has been demonstrated to be highly effective .

How does CPT1A-mediated fatty acid oxidation contribute to cancer cell resistance to immune surveillance?

CPT1A-mediated fatty acid oxidation (FAO) has been identified as a critical mechanism for cancer cell resistance to cytolytic immune cells :

Methodological approach: To study this phenomenon, researchers can use shRNA to knock down CPT1A in human cancer cell lines and assess changes in FAO rates using FAO diffusion assays and Seahorse assays, then evaluate susceptibility to immune-mediated cytolysis in co-culture systems with various immune effector cells .

What is the role of CPT1A in cardiac stress responses and cardioprotection?

Research has demonstrated that CPT1A upregulation appears to be an adaptive rather than maladaptive response to cardiac stress :

  • Clinical evidence:

    • Increased CPT1A protein levels observed in hearts of HFrEF (Heart Failure with reduced Ejection Fraction) patients

    • Similar findings in two different NICM (Non-Ischemic Cardiomyopathy) patient cohorts at two different institutions .

  • Experimental findings:

    • Cardiac-specific CPT1A knockout mice (csCPT1a ko) show exacerbated response to pressure overload (TAC)

    • AAV9-mediated cardiac CPT1A overexpression (54% increase) attenuates adverse cardiac remodeling

    • CPT1A functions beyond fat metabolism to inhibit gene programs associated with cardiac remodeling, including profibrotic, hypertrophic, and cell death responses .

  • Regulatory mechanisms:

    • miR370 regulates CPT1A expression in preclinical models

    • CPT1A mediates cardiac natriuretic peptide production .

Methodological approach: To investigate CPT1A's role in cardiac function, researchers can employ cardiac-specific CPT1A knockout mice (using Cre-loxP system) and AAV9-mediated gene delivery for cardiac-specific CPT1A overexpression, followed by TAC (Transverse Aortic Constriction) for pressure overload studies and assessment of cardiac remodeling parameters .

How does CPT1A influence ferroptosis resistance in cancer cells?

Recent research has uncovered CPT1A's critical role in ferroptosis resistance, particularly in cancer stem cells :

  • Mechanistic insights:

    • CPT1A restrains ubiquitination and degradation of c-Myc

    • c-Myc transcriptionally activates CPT1A expression, creating a positive feedback loop

    • This loop enhances cellular antioxidant capacity by activating the NRF2/GPX4 system

    • CPT1A reduces phospholipid polyunsaturated fatty acids through ACSL4 downregulation .

  • Implications for cancer therapy:

    • CPT1A inhibition enhances ferroptosis in cancer stem cells

    • Targeting CPT1A improves immune checkpoint blockade efficacy

    • L-carnitine derived from tumor-associated macrophages contributes to ferroptosis resistance .

Methodological approach: To study this phenomenon, researchers have employed approaches including metabolomics, transcriptomics, and lung epithelial-specific Cpt1a-knockout mouse models, combined with clinical analysis .

What technical considerations are important for designing high-throughput CPT1A activity assays?

When developing high-throughput assays for CPT1A activity, several technical aspects should be considered :

  • Detection method selection:

    • Radioisotope-based assays using 3H-carnitine offer high sensitivity but have safety limitations and limited access to scintillation equipment

    • Spectrophotometric detection of CoA using DTNB provides a reliable alternative that is more suitable for high-throughput applications .

  • Source of enzyme:

    • Direct cell lysis of human CPT1A-transformed Expi293 cells eliminates the need for purification of recombinant proteins

    • This approach provides highly reproducible and dose-responsive quantification for CPT1A activity .

  • Validation approach:

    • Use of previously reported CPT1A inhibitors (etomoxir, perhexiline, and chlorpromazine) as controls

    • Establishing dose-response curves to confirm assay sensitivity and reproducibility .

  • Assay optimization:

    • The spectrophotometric DTNB-based detection of free thiols provides a proxy for enzyme activity based on the direct relationship between CPT1A catalytic activity and increasing CoA concentration

    • This method has been validated to provide highly reproducible and dose-responsive quantification for CPT1A activity .

This optimized approach allows for cost-effective, safe, and scalable identification of CPT1A inhibitors, which may lead to potential treatments for type 2 diabetes and cancer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.