Recombinant Rat Carnitine O-palmitoyltransferase 1, muscle isoform (Cpt1b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Cpt1b; Carnitine O-palmitoyltransferase 1, muscle isoform; CPT1-M; Carnitine O-palmitoyltransferase I, muscle isoform; CPT I; CPTI-M; Carnitine palmitoyltransferase 1B; Carnitine palmitoyltransferase I-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-772
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT SWLVVVMATVGSNYCKVDISMGLVHCIQRCLPTRYGSYGTPQTETLLSMVIFSTGVWATG IFLFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS VPATIHRYLDSVRPLLDDEAYFRMESLAKEFQDKIAPRLQKYLVLKSWWATNYVSDWWEE YVYLRGRSPIMVNSNYYAMDFVLIKNTSQQAARLGNTVHAMIMYRRKLDREEIKPVMALG MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSCLLKPRDL EMQFQRILDDTSPPQPGEEKLAALTAGGRVEWAEARQKFFSSGKNKMSLDTIERAAFFVA LDEDSHCYNPDDEASLSLYGKSLLHGNCYNRWFDKSFTLISCKNGQLGLNTEHSWADAPI IGHLWEFVLATDTFHLGYTETGHCVGEPNTKLPPPQRMQWDIPEQCQTAIENSYQVAKAL ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG RTETVRSCTSESTAFVRAMMTGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL YIVSKYLGVRSPFLDEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADHGY GVSYMIAGENTMFFHVSSKLSSSETNALRFGNHIRQALLDIADLFKISKTDS
Uniprot No.

Target Background

Database Links
Protein Families
Carnitine/choline acetyltransferase family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
High expression in heart, skeletal muscle and brown adipose tissue. Also expressed in white adipose tissue, but not in liver.

Q&A

What is the biological function of Carnitine O-palmitoyltransferase 1, muscle isoform (Cpt1b)?

Carnitine O-palmitoyltransferase 1, muscle isoform (Cpt1b) is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria, representing a critical step in the regulation of fatty acid metabolism. Cpt1b functions at the nexus of lipid metabolism pathways, controlling the entry of fatty acids into the mitochondrial matrix where β-oxidation occurs . Unlike its liver isoform counterpart (Cpt1a), Cpt1b is predominantly expressed in brown adipose tissue (BAT), heart, skeletal muscle, and to some extent in white adipose tissue, reflecting its tissue-specific metabolic roles .

How does Cpt1b differ from other Cpt1 isoforms in terms of tissue distribution and function?

Cpt1 exists in multiple tissue-specific isoforms encoded on separate chromosomes:

  • Cpt1a (liver isoform): Expressed in liver, kidney, white adipose tissue (in male but not female mice), testis, ovary, pancreatic islet, lung, spleen, brain, intestine, and at much lower levels in heart .

  • Cpt1b (muscle isoform): Primarily expressed in brown adipose tissue (BAT), heart, skeletal muscle, testis, and white adipose tissue (in female but not male mice, and in humans) .

  • Cpt1c (brain isoform): Predominantly expressed in brain and regulates energy homeostasis, though its substrates remain poorly characterized .

These isoforms not only have tissue-specific expression patterns but are also affected by nutritional status, hormonal regulation, species differences, and developmental stage . Functionally, while Cpt1a and Cpt1b both facilitate long-chain fatty acid transport into mitochondria, Cpt1c appears to have different functions, including roles in neuronal fatty acid metabolism and energy homeostasis regulation .

What are the structural characteristics of Cpt1b that determine its function?

Cpt1b, like other Cpt1 isoforms, has a distinct structural organization that determines its function:

  • N-terminal domain (NT): Contains two transmembrane helices (residues 48-122) connected by a loop situated in the mitochondrial intermembrane space. The sequence between residues 97-147 is necessary for oligomerization, while residues 1-47 interact with the catalytic domain intramolecularly and mediate malonyl-CoA sensitivity .

  • Membrane topology: The enzyme has a specific membrane topology with transmembrane segments that anchor it to the mitochondrial outer membrane. This positioning is crucial for its function in fatty acid transport .

  • Catalytic domain: Contains the active site for transferring the acyl group from long-chain acyl-CoAs to carnitine.

  • Malonyl-CoA binding site: Allows for regulation of enzyme activity by malonyl-CoA, a key metabolic intermediate that inhibits Cpt1b activity .

The structural arrangement of these domains contributes to the enzyme's substrate specificity, regulatory properties, and membrane association .

What phenotypes are observed in Cpt1b knockout animal models?

Cpt1b knockout models have revealed critical insights into the physiological importance of this enzyme:

  • Homozygous knockout (Cpt1b−/−): Complete knockout of Cpt1b results in embryonic lethality before embryonic day 9.5-11.5, demonstrating that Cpt1b is essential for embryonic development .

  • Heterozygous knockout (Cpt1b+/−):

    • Under basal conditions: Appear phenotypically normal with approximately 50% reduction in Cpt1b mRNA expression in BAT, heart, and skeletal muscles .

    • Under pressure-overload conditions: Show increased susceptibility to heart failure with exacerbated cardiac hypertrophy and remodeling compared to wild-type littermates .

    • Demonstrate impaired cardiac contraction with greater eccentric cardiac hypertrophy .

    • Show exacerbated mitochondrial abnormalities and myocardial lipid accumulation with elevated triglycerides and ceramide content, leading to greater cardiomyocyte apoptosis .

  • Muscle-specific knockout (Cpt1bm−/−):

    • Show decreased mitochondrial fatty acid oxidation (FAO) in muscle tissues .

    • Have significantly reduced body weight and fat mass compared to control mice .

    • Demonstrate lower food intake over time, leading to cumulative differences in body composition .

    • Show upregulation of markers for FAO and uncoupling in adipose tissue .

    • Maintain low insulin values with age compared to controls whose insulin levels increase .

These phenotypes underscore the critical role of Cpt1b in energy metabolism, cardiac function, and whole-body metabolic homeostasis .

How do Cpt1b heterozygous models respond to pathological stress conditions?

Cpt1b heterozygous (Cpt1b+/−) models demonstrate a distinct vulnerability to pathological stress, particularly evident in cardiac function:

  • Response to pressure-overload:

    • Under severe pressure-overload conditions induced by transverse aorta constriction (TAC), Cpt1b+/− mice show dramatically increased susceptibility to premature death from congestive heart failure compared to wild-type littermates .

    • The majority of Cpt1b+/− mice die before completing a two-week term of severe pressure-overload, exhibiting signs of heart failure including dilated heart, effluence, and shortness of breath .

  • Cardiac remodeling under milder pressure-overload:

    • Even under milder pressure-overload conditions, Cpt1b+/− mice show more pronounced cardiac hypertrophy than wild-type littermates .

    • Echocardiographic assessments reveal greater increases in left posterior wall thickness, left ventricular dimension volume, and left ventricular mass in Cpt1b+/− mice .

    • Functional parameters including stroke volume, cardiac output, ejection fraction, and fraction shortening are further decreased in Cpt1b+/− mice compared to controls .

  • Cellular and molecular alterations:

    • Exacerbated mitochondrial abnormalities are observed in Cpt1b+/− hearts under stress .

    • Greater myocardial lipid accumulation occurs with elevated triglycerides and ceramide content .

    • Increased cardiomyocyte apoptosis is evident in stressed Cpt1b+/− hearts .

These findings suggest that while 50% reduction in Cpt1b activity may be tolerated under normal conditions, it becomes critically limiting during pathological stress, leading to accelerated cardiac dysfunction and failure .

What are the unexpected metabolic consequences of muscle-specific Cpt1b deficiency?

Muscle-specific Cpt1b deficiency (Cpt1bm−/−) produces several counterintuitive metabolic outcomes that challenge conventional understanding of fatty acid oxidation and insulin sensitivity:

  • Body composition changes:

    • Despite impaired muscle fatty acid oxidation, Cpt1bm−/− mice show decreased rather than increased body weight and fat mass .

    • Body weight and fat mass diverge significantly from control mice over time, with Cpt1bm−/− mice becoming approximately 3g lighter after 8 weeks .

    • Fat-free mass does not significantly differ until approximately 100 days of age .

  • Food intake patterns:

    • Cpt1bm−/− mice exhibit decreased food intake compared to controls .

    • Over an 8-week period, this leads to a cumulative difference of almost -15g in food intake .

  • Metabolic adaptations in adipose tissue:

    • Upregulation of β-oxidation enzymes occurs in adipose tissue, including 3-hydroxyacyl–CoA dehydrogenase and citrate synthase .

    • Uncoupling proteins and other thermogenic markers (Ucp-1, Cidea, Elovl3) are significantly elevated in adipose tissue of Cpt1bm−/− mice .

  • Insulin sensitivity:

    • Despite impaired fatty acid oxidation and lipid accumulation in muscle, which would conventionally predict insulin resistance, Cpt1bm−/− mice maintain insulin sensitivity .

    • Insulin values remain low in Cpt1bm−/− mice with age, while they increase in control mice .

    • Insulin tolerance tests show equivalent insulin response between weight-matched Cpt1bm−/− and control mice .

These findings challenge the lipotoxicity hypothesis, which proposes that decreased fatty acid oxidation leads to lipid accumulation and insulin resistance. Instead, they suggest that complex adaptive mechanisms involving cross-talk between tissues compensate for muscle-specific metabolic defects .

How can Cpt1b activity be accurately measured in tissue samples?

Measuring Cpt1b activity requires specific methodological approaches to capture its enzymatic function accurately:

  • Radiochemical forward assay:

    • Tissue specimens (e.g., liver, muscle) are homogenized in buffer containing protease and phosphatase inhibitors (10 mM potassium phosphate/150 mM NaCl, pH 7.4) .

    • Activity is determined by measuring the formation of palmitoylcarnitine from palmitoyl-CoA plus carnitine .

    • The reaction is conducted in duplicate for reliability, with appropriate controls to distinguish between Cpt1 isoforms .

    • This method directly quantifies the enzymatic conversion rate, providing a functional readout of Cpt1b activity.

  • Mitochondrial isolation and assessment:

    • Isolation of intact mitochondria from target tissues preserves the native membrane environment of Cpt1b.

    • Mitochondrial fatty acid oxidation can be measured with radiolabeled substrates, comparing wild-type samples to those treated with etomoxir (a specific inhibitor of Cpt1) .

    • This approach allows assessment of Cpt1b activity in its native mitochondrial context.

  • Considerations for accurate measurement:

    • Membrane composition significantly affects Cpt1 activity, as alterations in mitochondrial outer membrane fluidity due to changes in cholesterol content can influence enzyme function .

    • The choice of lipid or detergent for reconstitution in vitro may lock the enzyme in a state not representative of its physiological condition .

    • Temperature, pH, and substrate concentrations must be carefully controlled to ensure reproducible results.

These methodologies provide complementary information about Cpt1b function, with the radiochemical assay offering quantitative activity measurements and mitochondrial assays providing insights into the enzyme's behavior in its native environment .

What methods are used to generate and validate Cpt1b gene modifications in animal models?

Creating and validating Cpt1b gene modifications in animal models involves several sophisticated techniques:

  • Generation of knockout models:

    • Conventional knockout: Targeting constructs are designed to disrupt the Cpt1b gene through homologous recombination in embryonic stem cells .

    • Conditional knockout: Cre-loxP system is employed by crossing mice bearing floxed alleles of Cpt1b with tissue-specific Cre recombinase transgenic mice (e.g., Mlc1f-Cre for skeletal muscle-specific deletion) .

    • Heterozygous models: Can be maintained by crossing heterozygous mice with wild-type mates .

  • Validation of gene modification:

    • Genotyping: PCR-based methods to identify wild-type, heterozygous, and homozygous animals.

    • mRNA expression: Northern blot analysis to verify reduced (~50% in heterozygotes) or absent Cpt1b mRNA expression in target tissues .

    • Protein expression: Western blot analysis using specific antibodies against Cpt1b to confirm protein level changes .

    • Enzymatic activity: Direct measurement of Cpt1 activity in isolated mitochondria to confirm functional consequences of genetic modifications .

  • Tissue-specific recombination confirmation:

    • PCR-based approaches to verify Cre-mediated recombination in target tissues.

    • Immunohistochemistry to examine protein expression patterns in different tissues.

    • Activity assays compared between targeted and non-targeted tissues to confirm specificity .

  • Functional validation:

    • Mitochondrial fatty acid oxidation rates in isolated mitochondria from modified tissues .

    • Comparison of FAO rates between genetically modified samples and etomoxir-treated control samples to confirm similar inhibition profiles .

These comprehensive approaches ensure that Cpt1b modifications are correctly implemented and validated at the genetic, protein, and functional levels before phenotypic analyses are conducted .

How can researchers analyze the transcriptional regulation of the Cpt1b gene?

Analyzing transcriptional regulation of the Cpt1b gene requires multiple complementary approaches:

  • Promoter sequence analysis:

    • Screening the human Cpt1b gene 5'-flanking region (e.g., 1,000-bp upstream) for consensus transcription factor binding sites using tools like MATCH, a weight matrix-based program based on TRANSFAC .

    • Identification of potential regulatory elements such as USF binding sites that may control Cpt1b expression .

  • Electrophoretic mobility shift assay (EMSA):

    • Preparation of duplex radiolabeled oligonucleotide probes corresponding to putative transcription factor binding sites in the Cpt1b promoter .

    • Incubation with nuclear extracts (e.g., from C2C12 cells) to detect protein-DNA interactions .

    • Inclusion of specific and non-specific competitor probes to verify binding specificity .

    • Supershift assays using antibodies against specific transcription factors (e.g., USF-1, USF-2) to identify protein components of the DNA-protein complexes .

  • Epigenetic regulation assessment:

    • In vitro CpG methylation of EMSA probes using CpG methyltransferase (M.SssI) to evaluate how DNA methylation affects transcription factor binding .

    • Comparison between methylated and mock-methylated probes to determine methylation sensitivity of specific regulatory elements .

    • Analysis of differential epigenetic responses to environmental factors like lipid exposure in different physiological states .

  • Western blot analysis:

    • Detection of transcription factors (e.g., USF-1, USF-2) that may regulate Cpt1b expression using specific antibodies .

    • Quantification of protein levels in different physiological or pathological conditions to correlate with Cpt1b expression changes.

These techniques provide insights into the complex transcriptional regulation of Cpt1b, including identification of key regulatory elements, transcription factors involved, and epigenetic modifications that may influence gene expression in different metabolic states .

How does Cpt1b deficiency affect cardiac function under stress conditions?

Cpt1b deficiency has significant implications for cardiac function under stress conditions, revealing its crucial role in cardiac energy metabolism:

  • Pressure-overload response:

    • Heterozygous Cpt1b knockout mice (Cpt1b+/−) exhibit dramatically increased susceptibility to pressure-overload induced by transverse aorta constriction (TAC) .

    • Under severe pressure-overload, the majority of Cpt1b+/− mice die prematurely with signs of congestive heart failure .

    • Even under milder pressure-overload conditions, Cpt1b+/− mice show exacerbated cardiac hypertrophy and remodeling compared to wild-type littermates .

  • Cardiac structure and function alterations:

    • Echocardiographic assessment reveals significant increases in left posterior wall thickness (LVPW) at diastole, left ventricular dimension (LVPD) volume at systole, and left ventricular mass in Cpt1b+/− mice .

    • Functional parameters including stroke volume, cardiac output, ejection fraction (EF%), and fraction shortening (FS%) are substantially decreased in Cpt1b+/− mice under stress .

    • Heart weight to body weight and heart weight to tibia length ratios are elevated, indicating more pronounced cardiac hypertrophy .

  • Molecular and cellular mechanisms:

    • Cpt1b+/− hearts exhibit upregulation of molecular markers of cardiac hypertrophy, including natriuretic peptide precursors A & B (Nppa and Nppb) .

    • Exacerbated mitochondrial abnormalities are observed in stressed Cpt1b+/− hearts .

    • Myocardial lipid accumulation occurs with elevated triglycerides and ceramide content, leading to increased cardiomyocyte apoptosis .

  • Pathological significance:

    • The findings suggest that Cpt1b deficiency can cause lipotoxicity in the heart under pathological stress .

    • Even partial reduction in Cpt1b activity becomes critically limiting during cardiac stress conditions .

    • The results indicate that maintained fatty acid oxidation capacity is essential for cardiac adaptation to hemodynamic overload .

These observations establish Cpt1b as a critical factor in cardiac stress response, with its deficiency creating a metabolic vulnerability that compromises cardiac adaptation to hemodynamic challenges .

What is the relationship between Cpt1b expression and cancer?

Research has revealed significant associations between Cpt1b expression and certain cancer types, particularly in hematological malignancies:

  • Cpt1b as a prognostic marker in acute myeloid leukemia (AML):

    • Studies have identified Cpt1b as an independent risk factor in cytogenetically normal acute myeloid leukemia (CN-AML) .

    • High Cpt1b expression is associated with poor clinical outcomes in AML patients .

    • Analysis of The Cancer Genome Atlas (TCGA) cohort data shows significant correlation between Cpt1b expression levels and patient survival .

  • Clinical characteristics associated with Cpt1b expression:

    • Patients with high Cpt1b expression (n=243) show different clinical characteristics compared to those with low expression (n=81) .

    • High Cpt1b expression is associated with older patient age (median 55.00 vs 50.00 years, p=0.045) .

    • No significant differences are observed in bone marrow blast percentage, white blood cell count, hemoglobin levels, or platelet counts between high and low Cpt1b expression groups .

    • French-American-British (FAB) classification distribution and gene mutation frequencies (FLT3ITD, CEBPA, NPM1, DNMT3a, IDH1, IDH2) do not significantly differ between expression groups .

  • Prognostic significance in multivariate analysis:

    • Univariate analysis shows Cpt1b expression (High vs Low) as a significant prognostic factor (p=0.021, HR=1.526, 95% CI: 1.065-2.187) .

    • Other significant prognostic factors include age, white blood cell count, and specific gene mutations (FLT3ITD, NPM1, DNMT3a, CEBPA) .

  • Molecular mechanisms:

    • Genome-wide expression profile analysis reveals distinct patterns associated with high Cpt1b expression .

    • Changes in miRNA expression are observed in the high Cpt1b expression group .

    • Integrated analysis of mRNA and miRNA interactions suggests potential regulatory mechanisms .

    • Construction of competing endogenous RNA (ceRNA) networks provides insights into the molecular pathways affected by altered Cpt1b expression .

These findings highlight Cpt1b's potential role in cancer biology, particularly in hematological malignancies, suggesting its value as both a prognostic marker and potential therapeutic target .

How does Cpt1b interact with insulin signaling pathways in metabolic disorders?

The relationship between Cpt1b and insulin signaling pathways in metabolic disorders is complex and sometimes counterintuitive:

  • Unexpected effects in muscle-specific Cpt1b deficiency:

    • Contrary to predictions based on the lipotoxicity hypothesis, mice with muscle-specific Cpt1b deficiency (Cpt1bm−/−) do not develop insulin resistance despite impaired fatty acid oxidation and lipid accumulation in muscle .

    • Insulin values in Cpt1bm−/− mice remain low with age, while control mice show age-related increases in insulin levels .

    • Insulin tolerance tests (ITTs) demonstrate equivalent insulin response in weight-matched Cpt1bm−/− and control mice at both 10-12 weeks and 18-20 weeks of age .

  • Metabolic adaptations influencing insulin sensitivity:

    • Cpt1bm−/− mice show decreased whole-body adiposity despite impaired muscle fatty acid oxidation .

    • These mice exhibit reduced food intake over time, which contributes to differences in body composition .

    • Upregulation of fatty acid oxidation markers and uncoupling proteins in adipose tissue suggests compensatory metabolic adaptations that may preserve insulin sensitivity .

    • TNF-α mRNA levels (an inflammatory marker associated with insulin resistance) are significantly lower in Cpt1bm−/− mice by 16 weeks of age .

  • Lipid metabolites and insulin signaling:

    • Despite the conventional view that plasma non-esterified fatty acids (NEFAs), triglycerides (TAGs), intramyocellular diacylglycerols (DAGs), and ceramides are hallmarks of insulin resistance, Cpt1bm−/− mice maintain insulin sensitivity .

    • This suggests that the relationship between lipid accumulation and insulin resistance may be more complex than previously thought and may depend on specific lipid species or compensatory mechanisms .

  • Implications for metabolic disorder treatment approaches:

    • The findings challenge the notion that inhibiting muscle CPT1b would necessarily exacerbate insulin resistance .

    • They suggest that whole-body metabolic adaptations, including changes in food intake and adipose tissue metabolism, may compensate for muscle-specific metabolic defects .

    • These insights may inform novel therapeutic approaches for metabolic disorders that consider tissue-specific and whole-body metabolic interactions .

These observations reveal a nuanced relationship between Cpt1b activity and insulin signaling, suggesting that targeting muscle fatty acid oxidation may have unexpected systemic metabolic effects that could be therapeutically relevant .

How can structure-function analysis of Cpt1b inform the development of isoform-specific inhibitors?

Structure-function analysis of Cpt1b provides crucial insights for developing isoform-specific inhibitors with potential therapeutic applications:

  • Critical structural determinants of malonyl-CoA sensitivity:

    • The extreme amino terminus, particularly residue Glu-3 in rat liver Cpt1, is essential for sensitivity to inhibition by malonyl-CoA .

    • Mutations E3A (Glu-3 → Ala) or Δ(3-18) markedly lower sensitivity to malonyl-CoA compared to wild-type protein .

    • Interestingly, the Δ(1-82) mutant regains much of wild-type sensitivity, suggesting a region antagonistic to malonyl-CoA sensitivity exists within residues 19-82 .

    • The Δ(19-30) construct demonstrates 50-fold greater sensitivity than wild-type Cpt1 and >4-fold higher sensitivity than the native muscle isoform, confirming the presence of negative determinants of malonyl-CoA sensitivity .

  • Differential regulatory mechanisms between isoforms:

    • For muscle Cpt1 (Cpt1b), increasing deletions from Δ(3-18) to Δ(1-80) consistently decrease malonyl-CoA sensitivity, contrasting with the liver isoform behavior .

    • Deletion of residues 3-18 affects the Km for carnitine in muscle Cpt1 but not liver Cpt1, suggesting isoform-specific structural features that determine substrate affinity .

    • These observations provide evidence for an inverse relationship between affinity for malonyl-CoA and for carnitine between the two isoforms .

  • Membrane topology and oligomerization domains:

    • Cpt1 contains two transmembrane helices (residues 48-122) connected by a loop in the mitochondrial intermembrane space .

    • The sequence between residues 97-147 is necessary for oligomerization, while residues 1-47 interact with the catalytic domain and mediate malonyl-CoA sensitivity .

    • Understanding this topology is crucial for designing inhibitors that can access relevant binding sites in the native membrane environment .

  • Insights from related enzymes:

    • Structural studies of carnitine acetyltransferase (CrAT) show that just two point mutations (D356A and M564D) can convert it into a "pseudo CPT" .

    • Combined mutations Ala106Met/Thr465Val/Thr467Asn/Arg518Asn shift substrate preference from carnitine to choline .

    • These findings highlight the high degree of structural similarity among carnitine acyltransferases and can inform rational design of selective inhibitors targeting specific isoforms .

These structure-function insights provide a foundation for developing isoform-specific Cpt1 inhibitors that could have therapeutic potential in various metabolic disorders with minimal off-target effects .

What are the mechanisms underlying the embryonic lethality of homozygous Cpt1b knockout?

The embryonic lethality observed in homozygous Cpt1b knockout provides insights into the essential role of this enzyme in development:

  • Temporal pattern of embryonic loss:

    • Homozygous knockout of Cpt1b (Cpt1b−/−) results in embryonic loss before embryonic day 9.5-11.5 .

    • This timing coincides with critical developmental events including organogenesis and the establishment of placental circulation, suggesting Cpt1b may be essential for these processes .

  • Potential metabolic mechanisms:

    • Cpt1b is the rate-limiting enzyme for mitochondrial β-oxidation of long-chain fatty acids, which are the most abundant fatty acids in mammalian membranes and energy metabolism .

    • During early development, the embryo transitions from relying on maternal nutrient supply to establishing its own metabolic systems .

    • The embryonic period when Cpt1b−/− embryos are lost may represent a critical window when fatty acid oxidation becomes essential for energy production or biosynthetic processes .

  • Tissue-specific energy requirements:

    • Cpt1b is predominantly expressed in tissues with high energy demands, including heart and developing muscle .

    • Cardiac development and function, which begin around E8.0-8.5 in mice, may be particularly sensitive to defects in fatty acid metabolism .

    • The inability to utilize fatty acids for energy in these critical tissues likely contributes to developmental failure .

  • Comparison with other fatty acid oxidation defects:

    • Other enzymes in the fatty acid oxidation pathway, when knocked out, also cause embryonic lethality, supporting the critical nature of this metabolic pathway during development .

    • The timing of embryonic loss in Cpt1b−/− mice aligns with the developmental period when the embryo becomes increasingly dependent on its own metabolic processes rather than maternal supply .

  • Heterozygous viability but under-representation:

    • While Cpt1b+/− pups from crosses of Cpt1b+/− mice with wild-type mates are born in normal Mendelian ratios, the number of Cpt1b+/− pups from Cpt1b+/− breeding pairs is under-represented (63% of expected) .

    • This suggests partial haploinsufficiency or interactions between maternal and embryonic genotypes affecting viability .

Understanding these mechanisms has implications for human disorders of fatty acid metabolism and potential developmental origins of metabolic diseases .

How do epigenetic modifications influence Cpt1b expression in different physiological states?

Epigenetic modifications play a crucial role in regulating Cpt1b expression across various physiological states:

  • DNA methylation effects on transcription factor binding:

    • Specific CpG methylation within the Cpt1b promoter can significantly alter the binding of transcription factors that regulate gene expression .

    • In vitro CpG methylation of EMSA probes using CpG methyltransferase (M.SssI) demonstrates how DNA methylation affects transcription factor binding to regulatory elements in the Cpt1b promoter .

    • Comparison between methylated and mock-methylated probes reveals methylation sensitivity of specific regulatory elements, such as USF binding sites .

  • Differential response to lipid exposure:

    • The mRNA response of Cpt1b to lipid exposure differs significantly between lean and severely obese subjects, suggesting epigenetic programming of metabolic responses .

    • This differential epigenetic and transcriptional response may contribute to aberrant fatty acid metabolism in obesity and related disorders .

    • The research design specifically comparing these responses highlights how environmental factors (lipid exposure) interact with epigenetic mechanisms to regulate Cpt1b expression .

  • Tissue-specific epigenetic regulation:

    • Epigenetic modifications contribute to the tissue-specific expression patterns of Cpt1 isoforms .

    • Skeletal muscle, which primarily expresses Cpt1b, shows distinct epigenetic signatures compared to other tissues .

    • These tissue-specific epigenetic patterns help maintain metabolic specialization across different cell types .

  • Transcription factor binding sites subject to epigenetic regulation:

    • The human Cpt1b gene 1,000-bp 5′-flanking region contains multiple consensus transcription factor binding sites that may be subject to epigenetic regulation .

    • Specific sequences including USF binding sites (e.g., hCPT1B −539 5′-GGCCAGAGCCCCGTGCTGTGTATG-3′, hCPT1B −174, 5′-CACCATCCTCACGAGACTCTGGGG-3′) represent potential targets for epigenetic modification .

    • Supershift assays using antibodies against specific transcription factors (USF-1, USF-2) confirm protein components of DNA-protein complexes that may be affected by epigenetic changes .

Understanding these epigenetic regulatory mechanisms provides insights into how Cpt1b expression adapts to different physiological conditions and may identify potential therapeutic targets for metabolic disorders characterized by dysregulated fatty acid metabolism .

What are the optimal conditions for expressing and purifying recombinant rat Cpt1b?

Optimal expression and purification of recombinant rat Cpt1b requires careful consideration of several factors:

  • Expression systems:

    • Pichia pastoris expression system: Successfully used for expressing wild-type and mutant forms of rat Cpt1 proteins .

    • This eukaryotic expression system provides appropriate post-translational modifications and membrane insertion capability for this mitochondrial membrane protein .

    • The system allows for inducible expression and can generate sufficient quantities for biochemical and structural studies .

  • Critical considerations for functional expression:

    • Membrane environment: As Cpt1b is a mitochondrial outer membrane protein, maintaining appropriate membrane association is crucial for proper folding and function .

    • Detergent selection: The choice of detergent for extraction and purification significantly impacts enzyme stability and activity. The detergent must solubilize the protein while preserving its native conformation and activity .

    • Lipid composition: The lipid environment affects Cpt1 activity; changes in membrane fluidity due to cholesterol content can alter enzyme function .

  • Purification strategies:

    • Affinity tags: Addition of epitope tags (His, FLAG, etc.) facilitates purification while minimizing impact on enzyme activity.

    • Protease inhibitors: Inclusion of protease inhibitor cocktails during isolation protects against degradation .

    • Phosphatase inhibitors: Protein phosphatase inhibitor cocktails help maintain any regulatory phosphorylation states .

  • Activity preservation considerations:

    • Temperature sensitivity: Maintaining appropriate temperature during isolation and storage is critical for preserving enzymatic activity.

    • Buffer composition: Buffers containing 10 mM potassium phosphate/150 mM NaCl, pH 7.4 have been successfully used for Cpt1 isolation .

    • Stabilizing agents: Addition of glycerol or specific lipids may help stabilize the protein during and after purification.

  • Validation of functional activity:

    • Radiochemical assays: Measuring the formation of palmitoylcarnitine from palmitoyl-CoA plus carnitine confirms functional activity of purified protein .

    • Malonyl-CoA sensitivity: Testing inhibition by malonyl-CoA provides critical validation of proper folding and regulatory function .

These conditions must be optimized to ensure that recombinant rat Cpt1b maintains its native structure, membrane association, and enzymatic activity for reliable experimental studies .

What are the key considerations for designing specific PCR primers for rat Cpt1b detection?

Designing specific PCR primers for rat Cpt1b detection requires careful consideration of several factors to ensure specificity, sensitivity, and reproducibility:

  • Isoform specificity:

    • Rat genome contains multiple Cpt1 isoforms (Cpt1a, Cpt1b, Cpt1c) with sequence similarities, making isoform-specific detection challenging .

    • Primers must target regions unique to Cpt1b to avoid cross-amplification of other isoforms .

    • Example of specific primers for Cpt1b: 5'-CCTGCTACATGGCAACTGCTA-3' (sense) and 5'-AGAGGTGCCCAATGATGGGA-3' (antisense) .

  • Splice variant considerations:

    • Multiple transcript variants encoding different isoforms have been identified for Cpt1b .

    • Primer design should account for known splice variants to ensure comprehensive detection or specifically target certain variants as needed.

    • Consideration of exon-exon junctions in primer design can help distinguish genomic DNA from cDNA.

  • Control gene selection:

    • Appropriate reference genes are essential for reliable quantification.

    • GAPDH is commonly used: 5'-GGAGCGAGATCCCTCCAAAAT-3' (sense) and 5'-GGCTGTTGTCATACTTCTCATGG-3' (antisense) .

    • Validation of reference gene stability across experimental conditions is necessary for accurate relative quantification.

  • PCR optimization parameters:

    • Annealing temperature: Optimized to balance specificity and efficiency.

    • Amplicon length: Typically 80-200 bp for qPCR applications.

    • GC content: Balanced to ensure stable binding without excessive secondary structure.

    • Secondary structures: Minimized to prevent reduced amplification efficiency.

  • Validation approaches:

    • Melting curve analysis: To confirm single product amplification.

    • Sequencing of amplicons: To verify target specificity.

    • Standard curves: To determine amplification efficiency.

    • No-template and no-reverse transcriptase controls: To detect potential contamination or genomic DNA amplification.

  • Application-specific considerations:

    • For genotyping: Primers flanking targeted regions to distinguish wild-type, heterozygous, and homozygous knockout animals .

    • For expression analysis: Primers targeting conserved regions to ensure comprehensive detection of all relevant transcripts .

    • For mutation detection: Primers designed to specifically amplify wild-type or mutant sequences .

Careful attention to these considerations ensures reliable detection and quantification of rat Cpt1b in various experimental contexts .

How can researchers effectively use ELISA and immunoblotting techniques for Cpt1b quantification?

Effective use of ELISA and immunoblotting techniques for Cpt1b quantification requires specific methodological approaches:

  • ELISA-based quantification:

    • Sample preparation: ELISA kits are designed to detect native Cpt1b in appropriate sample types including undiluted body fluids and/or tissue homogenates, requiring minimal processing to preserve protein conformation .

    • Specificity considerations: Kits should be validated to detect native, not recombinant, Cpt1b to ensure physiologically relevant measurements .

    • Standard curve generation: Using purified or recombinant Cpt1b standards for accurate quantification.

    • Detection range optimization: Ensuring sample dilutions fall within the linear range of the assay.

    • Cross-reactivity assessment: Confirming antibody specificity for Cpt1b without cross-reactivity to other Cpt1 isoforms (Cpt1a, Cpt1c) .

  • Immunoblotting techniques:

    • Antibody selection: Use of isoform-specific antibodies is critical, such as those produced against specific peptide sequences unique to Cpt1b .

    • Antibody validation: Validation against epitope-tagged constructs (e.g., testing antibodies against mCPT1a and mCPT1b constructs) to confirm specificity .

    • Affinity purification: Purification of antibodies from rabbit serum using specific peptides improves specificity .

    • Detection system optimization: Using horseradish peroxidase-conjugated secondary antibodies and chemiluminescent substrates (e.g., SuperSignal) for sensitive detection .

  • Technical considerations for mitochondrial membrane proteins:

    • Sample preparation: Special considerations for membrane protein extraction from mitochondria, potentially requiring detergent-based methods that preserve native conformation.

    • Protein denaturation conditions: Optimization of heating temperature and detergent conditions to ensure complete denaturation without aggregation.

    • Gel percentage selection: Appropriate polyacrylamide percentage based on Cpt1b's molecular weight (~88 kDa).

    • Transfer conditions: Optimization for efficient transfer of high molecular weight membrane proteins, potentially using lower methanol concentrations or specialized transfer buffers.

  • Quantification methods:

    • Densitometric analysis: For semi-quantitative assessment of immunoblot band intensity.

    • Normalization strategies: Using appropriate loading controls (e.g., mitochondrial proteins for mitochondrial fractions) to account for variations in sample loading and transfer efficiency.

    • Standard curve inclusion: Including recombinant protein standards on immunoblots for absolute quantification.

  • Validation approaches:

    • Knockout controls: Including samples from Cpt1b knockout models as negative controls to confirm antibody specificity .

    • Peptide competition: Pre-incubation of antibodies with immunizing peptides to verify binding specificity.

    • Multiple antibody validation: Using different antibodies targeting distinct epitopes to confirm observations.

These methodological considerations ensure accurate and reliable quantification of Cpt1b protein levels in various experimental contexts .

What are the most promising future research directions for Cpt1b in metabolic disease therapy?

Several promising future research directions for Cpt1b in metabolic disease therapy emerge from current evidence:

  • Tissue-specific Cpt1b modulation:

    • The paradoxical findings that muscle-specific Cpt1b deficiency does not induce insulin resistance but rather promotes favorable whole-body metabolism suggests tissue-specific targeting could offer therapeutic benefits .

    • Developing approaches to selectively modulate Cpt1b activity in specific tissues might allow exploitation of beneficial metabolic adaptations while avoiding adverse effects in tissues like heart where Cpt1b inhibition could be detrimental .

  • Isoform-specific inhibitor development:

    • Structure-function studies revealing distinct regulatory domains and malonyl-CoA sensitivity determinants provide the foundation for designing highly selective Cpt1b inhibitors .

    • Targeting the negative regulatory domains (e.g., residues 19-30) identified in structure-function studies could potentially enhance rather than inhibit Cpt1b sensitivity to natural regulatory mechanisms .

    • These approaches could overcome the limitations of current broad-spectrum Cpt1 inhibitors that lack isoform selectivity.

  • Cpt1b as a biomarker and therapeutic target in cancer:

    • The identification of Cpt1b as an independent risk factor in certain cancers, particularly cytogenetically normal acute myeloid leukemia (CN-AML), suggests its potential as both a prognostic biomarker and therapeutic target .

    • Further research into the molecular mechanisms connecting Cpt1b expression with cancer progression, including the identified competing endogenous RNA (ceRNA) networks, could reveal novel intervention points .

  • Epigenetic regulation of Cpt1b:

    • Understanding how epigenetic modifications influence Cpt1b expression in different physiological states could open avenues for epigenetic therapies targeting metabolic disorders .

    • The differential response of Cpt1b to lipid exposure between lean and obese subjects suggests personalized approaches targeting these epigenetic mechanisms might be effective .

  • Cardioprotective strategies targeting Cpt1b:

    • The vulnerability of Cpt1b-deficient hearts to pressure overload suggests that enhancing cardiac Cpt1b activity could be cardioprotective in heart failure conditions .

    • Developing approaches to prevent lipotoxicity by maintaining or enhancing cardiac fatty acid oxidation capacity represents a paradigm shift from traditional approaches focusing on glucose utilization .

  • Cross-talk between tissues in metabolic regulation:

    • The unexpected systemic effects of muscle-specific Cpt1b deficiency highlight the importance of inter-tissue metabolic communication .

    • Further research into how Cpt1b activity in one tissue influences metabolism in others could reveal novel therapeutic targets for integrated metabolic disease management .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.