Recombinant Rat Catechol O-methyltransferase (Comt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
Comt; Catechol O-methyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Uniprot No.

Target Background

Function
Catechol O-methyltransferase (COMT) catalyzes the O-methylation and subsequent inactivation of catecholamine neurotransmitters and catechol hormones. It also shortens the biological half-lives of certain neuroactive drugs, such as L-DOPA, alpha-methyl DOPA, and isoproterenol.
Gene References Into Functions
  1. Alterations observed in the expression levels of catechol-o-methyltransferase, mineralocorticoid receptor, and the b-subunit of epithelial sodium channel confirm their involvement in enhanced sympathetic stimulation in hypertensive rats. PMID: 27215035
  2. Hepatic COMT activity was found to be higher in the mineral water group compared to the tap water and tap-water-plus-NaCl groups. Conversely, adrenal gland COMT mRNA expression decreased in the mineral water group compared to the tap water group. PMID: 25560240
  3. COMT inhibition leads to increased pain sensitivity and production of proinflammatory mediators. PMID: 24727346
  4. Our findings indicate that COMT regulates dorsal hippocampal neurochemistry and modulates hippocampus-dependent behaviors. PMID: 22815336
  5. ZNF804a regulates the expression of schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2. PMID: 22384243
  6. Decreased COMT activity was associated with certain changes in feeding microstructure in rats and mice. PMID: 21851556
  7. This study investigated substrate specificity and metabolite profiles of COMT from liver cytosol, including molecular modeling. PMID: 22071171
  8. This research analyzed the orientation and cellular distribution of membrane-bound catechol-O-methyltransferase in cortical neurons. PMID: 21846718
  9. In a rat subarachnoid hemorrhage model, COMT expression was observed in the rat striatum at an early stage. PMID: 21116937
  10. Reduced COMT enzyme activity, potentially leading to catecholamine accumulation, inhibits spinal nociceptive activity and attenuates the expression of spinal long-term potentiation (LTP). PMID: 20219633
  11. Significant effects of hormone replacement and gonadectomy on catechol-O-methyltransferase and monoamine oxidase isoforms were observed in both the striatum and cortex. PMID: 19909795
  12. These findings suggest that decreased COMT expression may be a significant factor contributing to the development of hypertension. PMID: 19966533
  13. Contrary to expectations that COMT would be predominantly expressed in non-neuronal cells, this study demonstrates that neurons are the primary cell population expressing COMT mRNA in the rat forebrain. PMID: 12535946
  14. Liver membrane-bound-catechol-O-methyltransferase might play a role in blood pressure regulation in rats. PMID: 14714585
  15. Strong COMT mRNA expression was observed in the suprachiasmatic nucleus throughout its rostrocaudal extent on postnatal day 1 (P1) and P2, with gradual mRNA level decrease until P16. PMID: 15167541
  16. Crystals diffract to 1.6 A resolution on a synchrotron-radiation source and belong to the monoclinic space group P2(1). PMID: 16508109
  17. This research provides the first direct evidence that low COMT activity leads to increased pain sensitivity through a beta(2/3)-adrenergic mechanism. PMID: 17084978
  18. Suppression of catechol-O-methyltransferase activities, reduced degradation of norepinephrine (NE), and increased NE release by blunting alpha(2)-AR function might be involved in salt-sensitive hypertension in Dahl salt-sensitive rats. PMID: 17510509
  19. Catechol-O-methyltransferase activity and protein expression increased in the substantia nigra after inflammation induced by lipopolysaccharides. PMID: 17573159
  20. Modulation of COMT activity may play a role in regulating myometrial contractility and cervical ripening during pregnancy. PMID: 18042640
  21. pI differences distinguishing between various COMT forms are due to unidentified structural modifications. PMID: 18831714
  22. This work reports the first crystallographic study of Rat COMT complexed with a non-nitrocatechol inhibitor. PMID: 19056347
  23. The crystal structures of the Apo and Holo forms of rat catechol-O-methyltransferase were determined and compared. PMID: 19111934

Show More

Hide All

Database Links

KEGG: rno:24267

STRING: 10116.ENSRNOP00000043148

UniGene: Rn.220

Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.

Q&A

What is rat Catechol O-methyltransferase (Comt) and what is its primary function?

Catechol O-methyltransferase (COMT) is a Mg²⁺-dependent enzyme that catalyzes the transfer of methyl groups from S-adenosyl methionine to a hydroxyl group of catecholic substrates. It plays a crucial role in the metabolic degradation of catecholamine neurotransmitters (dopamine, norepinephrine, and epinephrine) and catechol hormones. Specifically, COMT converts dopamine to 3-methoxytyramine and norepinephrine to normetanephrine .

The enzyme catalyzes O-methylation, thereby inactivating catecholamine neurotransmitters and catechol hormones. It also shortens the biological half-lives of certain neuroactive drugs, including L-DOPA, alpha-methyl DOPA, and isoproterenol . This methylation process represents one of the major pathways for catecholamine degradation in mammals, working alongside monoamine oxidases (MAO-A and MAO-B) .

What are the different forms of COMT in rats and how are they expressed?

Rat COMT exists in two main forms:

  • Soluble COMT (S-COMT): A 24 kDa cytosolic protein

  • Membrane-bound COMT (MB-COMT): A 28 kDa protein associated with cell membranes

Both forms are encoded by a single gene through the cooperation of two separate promoters:

  • The P1 promoter: Regulated in a tissue-specific manner

  • The P2 promoter: Functions constitutively

Research has demonstrated that upstream sequences of the P1 promoter contain several regions that modulate expression either positively or negatively. The region between the MB-COMT and S-COMT ATG translation initiation codons is indispensable for P1 promoter activity . Through DNase I footprinting and gel retardation assays, researchers have identified several DNA elements with SP1 and NF1 recognition site homologies that bind both liver and brain nuclear proteins. An 11-nucleotide-long DNA region containing an overlapping consensus binding sequence for CREB and C/EBP-like factors reacts only with liver nuclear lysate, suggesting that transcription factor C/EBPalpha mediates the tissue-specific expression of the rat COMT P1 promoter .

What is the tissue distribution pattern of COMT in rats?

COMT is widely distributed throughout rat tissues, with varying expression levels:

TissueCOMT PresenceRelative Intensity
LiverWidespreadMost intense
KidneyWidespreadMost intense
StomachEpithelial cellsModerate
DuodenumEpithelial cellsModerate
IleumEpithelial cellsModerate
Pancreasβ-cells (insulin-producing), D-cells (somatostatin-producing)Moderate
Pancreasα-cells (glucagon-producing)Not detected
PituitaryCleft cells, pituicytes (posterior lobe), anterior lobeVariable
ThyroidEpithelial cellsModerate
Adrenal cortexZona glomerulosaModerate
BrainEpendymal cells of cerebral ventricles, choroid plexusBrightest
BrainNeuropil of striatum and cortexWeak to moderate
SpinalScattered small neurons in sensory gangliaModerate

The most intense immunoreactivity is observed in the liver and kidney. In the brain, the brightest immunofluorescence is seen in ependymal cells of the cerebral ventricles and choroid plexus, with weak to moderate immunofluorescence in the neuropil of several brain areas including striatum and cortex .

How does the relative importance of COMT in catecholamine metabolism vary across brain regions?

The relative contribution of methylation (by COMT) versus deamination (by MAO) in the metabolic degradation of catecholamines varies significantly among brain regions. Pharmacological studies suggest that methylation accounts for:

  • Approximately 15% of released dopamine metabolism in the striatum and nucleus accumbens

  • More than 60% of dopamine metabolism in the frontal cortex

This regional variation has important implications for both basic research and investigations into neurological and psychiatric disorders. COMT is absent from dopaminergic terminals and is thought to be involved primarily in the catabolism of extraneuronal dopamine in glial cells and/or postsynaptic neurons . This regional specificity should be carefully considered when designing experiments targeting specific neural circuits or brain functions.

What sex differences exist in COMT expression and function?

COMT activity exhibits notable sexual dimorphism. Studies have shown:

  • Human females have significantly lower COMT activity in the liver compared to males, with differences attributed to epigenetic mechanisms .

  • Estrogens can reduce COMT activity epigenetically in several species .

  • COMT mutant mice demonstrate sexually dimorphic and region-specific changes in dopamine levels, particularly in the frontal cortex .

  • Homozygous COMT-deficient female mice (but not males) display impaired emotional reactivity in anxiety models .

  • Heterozygous COMT-deficient male mice exhibit increased aggressive behavior .

These findings provide strong evidence for an important sex- and region-specific contribution of COMT in maintaining steady-state levels of catecholamines in the brain and suggest its role in emotional and social behavior regulation . Researchers should account for these sex differences when designing studies and interpreting results.

How does oxidative stress affect COMT activity and structure?

Oxidative stress significantly impacts COMT activity, particularly through the oxidation of methionine residues. Research has shown that:

  • Methionine sulfoxide reductase (MsrA) positively regulates COMT activity, especially under oxidative conditions .

  • Brains of MsrA knockout mice exhibit markedly reduced COMT activity compared to wild-type counterparts .

  • Treatment with reducing agents (DTT) significantly enhances COMT activity, with concentration-dependent effects:

    • Increasing DTT from 2mM to 20mM causes significant increases in COMT activity

    • The addition of recombinant MsrA in the presence of 20mM DTT further increases activity

  • In MsrA knockout mice, COMT activity is significantly reduced, but can be partially restored with high DTT concentrations and recombinant MsrA treatment .

These findings suggest that COMT contains methionine residues susceptible to oxidation, and that MsrA plays a crucial role in maintaining COMT activity by reducing oxidized methionine residues. This relationship between oxidative stress and COMT function has important implications for understanding neurodegenerative and psychiatric disorders associated with oxidative stress.

What are the optimal methods for measuring COMT activity in rat tissue samples?

For measuring COMT activity in rat tissue samples, several methodological approaches are available:

  • Enzyme activity assays:

    • Using purified recombinant enzyme with specific substrates

    • Monitoring the transfer of methyl groups from S-adenosyl methionine to catechol substrates

    • Measuring reaction products via HPLC or mass spectrometry

  • Reducing conditions optimization:

    • Include DTT in reaction buffers (typically 2-20mM) to maintain cysteine residues in reduced form

    • Higher DTT concentrations (20mM) significantly increase COMT activity compared to lower concentrations (2mM)

    • Consider adding recombinant MsrA to further enhance activity, especially for oxidized samples

  • Controls and normalization:

    • Include both positive controls (known active COMT) and negative controls (heat-inactivated enzyme)

    • Normalize activity to total protein concentration

    • Consider tissue-specific variations in COMT expression when comparing across samples

The choice of method should be determined by the specific research question, available equipment, and desired sensitivity and throughput.

What are effective approaches for detecting and quantifying COMT protein levels in rat samples?

Several techniques are available for detecting and quantifying COMT protein levels in rat samples:

  • ELISA:

    • Commercial rat COMT ELISA kits offer high sensitivity (0.078ng/mL) and specificity

    • Detection range: 0.156-10ng/mL

    • Suitable for serum, plasma, tissue homogenates, and cell culture supernatants

    • Intra-assay CV: 4.4%, Inter-assay CV: 7.2%

  • Immunohistochemistry/Immunofluorescence:

    • Using specific antisera prepared against recombinant rat COMT

    • Can detect both 24 kDa soluble and 28 kDa membrane-bound forms

    • Allows visualization of tissue distribution patterns

  • Western Blotting:

    • Enables detection of both S-COMT and MB-COMT forms

    • Allows quantification of relative expression levels

    • Can be combined with subcellular fractionation to distinguish membrane-bound versus soluble forms

  • Immunoprecipitation:

    • Useful for isolating COMT complexes and studying protein-protein interactions

    • Can confirm specificity of antibodies

Each method has strengths and limitations, and researchers should select based on their specific experimental needs and available resources.

How can recombinant rat COMT be produced for research applications?

Production of recombinant rat COMT typically involves the following steps:

  • Cloning and expression vector selection:

    • Isolate rat COMT cDNA (either S-COMT or MB-COMT variant)

    • Clone into appropriate expression vector with suitable tags (His-tag commonly used)

    • Consider codon optimization for the expression system

  • Expression system options:

    • Prokaryotic (E. coli): Higher yields but potential issues with post-translational modifications

    • Eukaryotic (insect cells, mammalian cells): Better for proper folding and modifications

    • Cell-free systems: Rapid production but potentially lower yields

  • Purification strategy:

    • Affinity chromatography (using His-tag or other fusion tags)

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

  • Activity verification:

    • Enzymatic assays using standard COMT substrates

    • Verification of proper folding using circular dichroism

    • Thermal stability assessment

  • Storage considerations:

    • Addition of stabilizing agents (glycerol, reducing agents)

    • Aliquoting to avoid freeze-thaw cycles

    • Storage at -80°C for long-term preservation

When producing recombinant COMT, it's essential to verify that the recombinant protein maintains the same kinetic properties and substrate specificities as the native enzyme.

What genetic models are available for studying COMT function in rodents?

Several genetic models have been developed for studying COMT function:

  • COMT knockout mice:

    • Created through homologous recombination in embryonic stem cells

    • Allow study of complete COMT deficiency

    • Exhibit region-specific changes in dopamine levels

    • Show sex-specific behavioral phenotypes:

      • Homozygous COMT-deficient females display impaired emotional reactivity

      • Heterozygous COMT-deficient males show increased aggressive behavior

  • MsrA knockout mice:

    • Indirect model affecting COMT function through reduced ability to repair oxidized methionine residues

    • Show significantly reduced COMT activity in brain tissue

    • Demonstrate the importance of post-translational regulation of COMT

  • Conditional and tissue-specific knockouts:

    • Allow temporal and spatial control of COMT expression

    • Useful for distinguishing developmental versus acute effects

    • Help determine tissue-specific roles of COMT

  • Transgenic overexpression models:

    • Overexpress wild-type or mutant COMT in specific tissues

    • Useful for studying gain-of-function effects

These models provide powerful tools for investigating the neurobiological, behavioral, and physiological roles of COMT in different contexts.

How can COMT activity be manipulated experimentally in rat models?

COMT activity can be manipulated through several experimental approaches:

  • Pharmacological inhibition:

    • Use of selective COMT inhibitors (e.g., tolcapone, entacapone)

    • Dose-dependent effects can be achieved

    • Temporal control through timed administration

    • Consider brain penetration for CNS studies

  • Genetic approaches:

    • RNA interference (siRNA, shRNA) for transient knockdown

    • CRISPR/Cas9 genome editing for permanent modifications

    • Viral vectors for local expression changes in adult animals

  • Modulation of redox state:

    • Administration of oxidizing or reducing agents

    • Manipulation of MsrA activity to indirectly affect COMT function

    • Treatment with DTT (2-20mM) can enhance COMT activity in ex vivo assays

  • Hormonal manipulation:

    • Estrogen administration or ovariectomy to exploit the hormone-sensitive regulation of COMT

    • Consider sex differences in experimental design

Each approach has advantages and limitations, and the choice depends on the specific research question, desired temporal control, and target tissue specificity.

What are important considerations when comparing COMT findings between rats and other species?

When comparing COMT findings between rats and other species, several factors should be considered:

  • Sequence and structural differences:

    • Mouse COMT contains additional methionine residues at positions 93 and 244 compared to human COMT

    • Mouse COMT features leucine at position 151, homologous to 108/158 in human COMT

    • These differences may affect enzyme activity, substrate specificity, and sensitivity to inhibitors

  • Promoter and regulatory differences:

    • Species variations in P1 and P2 promoter structures and regulatory elements

    • Differences in tissue-specific expression patterns

    • Variable responses to hormonal regulation

  • Methodological considerations:

    • Antibody cross-reactivity should be validated across species

    • Activity assay conditions may need optimization for each species

    • Consider differences in optimal pH, temperature, and cofactor requirements

  • Behavioral correlates:

    • Species-specific behavioral effects of COMT manipulation

    • Different baseline behaviors and testing paradigms across species

    • Consider evolutionary conservation of neural circuits affected by COMT

Understanding these species differences is crucial for translating findings from rat models to other experimental systems and eventually to human applications.

What are the current knowledge gaps in rat COMT research?

Despite extensive research, several knowledge gaps remain:

  • The complete mechanisms regulating tissue-specific COMT expression remain incompletely understood, particularly the interplay between the P1 and P2 promoters in different physiological contexts .

  • The dynamic regulation of COMT in response to environmental challenges and stressors requires further investigation.

  • The role of COMT in non-neuronal tissues and its potential significance in peripheral catecholamine metabolism needs more thorough characterization .

  • The functional significance of the wide distribution of COMT across various rat tissues suggests important roles beyond neurotransmitter metabolism that warrant further exploration .

What emerging techniques might advance rat COMT research?

Several emerging techniques hold promise for advancing rat COMT research:

  • Single-cell transcriptomics and proteomics:

    • Enable cell type-specific analysis of COMT expression

    • Reveal previously undetected heterogeneity in COMT distribution

  • In vivo imaging techniques:

    • Real-time monitoring of COMT activity in living animals

    • Correlation with behavioral and physiological parameters

  • CRISPR-based epigenetic editing:

    • Targeted modification of COMT regulatory elements

    • Investigation of tissue-specific expression mechanisms

  • Computational modeling:

    • Simulation of COMT-mediated catecholamine metabolism in different tissues

    • Integration of multiple datasets to predict system-level effects

These approaches will provide more comprehensive understanding of COMT biology and its implications for health and disease.

How might findings from rat COMT research translate to human health applications?

Rat COMT research has several potential translational implications:

  • Psychiatric disorders:

    • COMT is considered a candidate gene for several psychiatric disorders

    • Understanding sex differences in COMT function may help explain sex-biased prevalence of certain mental health conditions

  • Neurodegenerative diseases:

    • The role of COMT in oxidative stress responses may inform therapeutic approaches for conditions like Parkinson's disease

    • The interaction between COMT and MsrA suggests new therapeutic targets

  • Pain management:

    • COMT affects catecholamine levels that modulate pain perception

    • Findings may inform development of novel analgesics

  • Precision medicine:

    • Understanding individual variations in COMT function may help personalize treatments for conditions affected by catecholamine metabolism

    • Rat models can help predict effects of human COMT polymorphisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.