Recombinant Rat CD320 antigen (Cd320)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag type is required, please specify it in your order for preferential development.
Synonyms
Cd320; CD320 antigen; Transcobalamin receptor; TCblR; CD antigen CD320
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-264
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Cd320
Target Protein Sequence
APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRI EPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRC DGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNP NAYGVIAAAGVLSAILVSATILILLRLRGQGYLPPTGLLVAVKESLLLSERKTSLI
Uniprot No.

Target Background

Function

Recombinant Rat CD320 antigen (Cd320) is a receptor for transcobalamin saturated with cobalamin (TCbl), playing a crucial role in cobalamin uptake. Expressed on follicular dendritic cells (FDCs), it's a plasma membrane protein mediating interaction with germinal center B cells. It functions as a costimulator, promoting B cell responses to antigenic stimuli, and enhancing B cell differentiation and proliferation. Germinal center B (GC-B) cells differentiate into memory B cells and plasma cells (PCs) through interactions with T cells and FDCs. CD320 augments the proliferation of PC precursors generated by IL-10.

Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is CD320 and what are its primary biological functions?

CD320, also known as TCblR or 8D6A, is a single-pass type I membrane protein containing two LDL-receptor class A domains. It functions primarily as the receptor for cellular uptake of transcobalamin-bound cobalamin (vitamin B12). CD320 is expressed abundantly on follicular dendritic cells (FDCs) and has been shown to enhance proliferation of germinal center (GC) B cells. The protein plays a critical role in vitamin B12 metabolism, with defects in CD320 being associated with methylmalonic aciduria type TCblR (MMATC) .

Beyond its canonical function in vitamin B12 uptake, CD320 participates in complex cellular signaling networks, particularly within the immune system. Experimental approaches investigating CD320-dependent pathways should account for both its transport function and potential signaling capabilities. For comprehensive functional analysis, researchers should combine binding assays with downstream metabolic assessments .

How does rat CD320 differ structurally and functionally from human CD320?

FeatureHuman CD320Rat CD320
Amino acid sequence homologyReference~87% identity
Glycosylation patternsExtensive complex glycosylationSimilar but with species-specific modifications
Observed MW on SDS-PAGE60-70 kDa, 35-40 kDaTypically 60-65 kDa
Binding affinity for TC-CblWell-characterizedMay exhibit slightly different kinetics

When conducting cross-species studies, researchers should account for these structural variations, particularly when using antibodies raised against human CD320 for detecting rat CD320. The aberrant mobility observed in human CD320 by SDS-PAGE (calculated 29 kDa vs. observed 60-70 kDa) is likely present in rat CD320 as well, attributed to extensive complex glycosylation patterns .

What are the optimal expression systems for producing recombinant rat CD320?

For recombinant rat CD320 production, mammalian expression systems are strongly preferred over bacterial systems due to the requirement for proper post-translational modifications, particularly glycosylation. Based on experimental evidence with human CD320:

  • HEK293 cells represent an optimal expression system, providing appropriate folding and post-translational modifications essential for functional activity .

  • Methodology considerations:

    • Construct design should include the extracellular domain (amino acids 32-229 in human; comparable region in rat)

    • Signal peptide inclusion is essential for proper membrane targeting

    • Consider adding a fusion tag (His, FLAG, or Fc) for purification purposes, positioned to minimize interference with functional domains

  • Expression verification requires multiple approaches, as the extensive glycosylation impacts apparent molecular weight. Always confirm expression using both anti-tag antibodies and specific anti-CD320 antibodies in Western blot analysis .

What are the recommended methods for detecting and quantifying rat CD320 expression?

Multiple complementary approaches are recommended for robust detection and quantification of rat CD320 expression:

  • Western Blot Analysis:

    • Recommended dilution: 1:500-1:3000 for polyclonal antibodies

    • Expected molecular weight: 60-70 kDa (primary band) with potential secondary band at 35-40 kDa

    • Critical controls: CD320 knockout samples or siRNA-treated samples

    • Sample preparation: Use of proper lysis buffers containing protease inhibitors is essential

  • Immunohistochemistry (IHC):

    • Recommended dilution: 1:500-1:2000

    • Antigen retrieval: TE buffer (pH 9.0) is preferred; alternative: citrate buffer (pH 6.0)

    • Expected expression patterns: Prominent in placenta, kidney, and lymphoid tissues

  • Immunofluorescence (IF):

    • Similar dilutions to IHC

    • Particularly useful for co-localization studies with transcobalamin or endocytic markers

  • Flow Cytometry:

    • Valuable for quantifying surface expression in immune cells

    • Requires careful titration of antibodies and appropriate isotype controls

For all detection methods, comparative analysis with human tissues can provide important controls, but species-specific optimization is essential for accurate results .

How can researchers effectively purify recombinant rat CD320 while maintaining its functional properties?

Purification of functionally active recombinant rat CD320 requires a carefully designed strategy:

  • Three-Step Affinity Purification Protocol:

    • Initial capture: TC-Cbl affinity matrix binding

    • Secondary purification: Anti-TC affinity matrix

    • Final polishing: Lectin affinity chromatography using Con A agarose

  • Critical Buffer Considerations:

    • Solubilization buffer: 25 mM HEPES (pH 7.4) containing 1% CHAPSO, 150 mM NaCl, 2 mM CaCl2, with protease inhibitors

    • Washing buffer: 25 mM HEPES (pH 7.4), 0.1% CHAPSO, 150 mM NaCl, 2 mM CaCl2

    • Elution conditions: 0.5 M MgCl2 effectively releases bound receptor while maintaining structural integrity

  • Functional Verification:

    • Binding assays using labeled TC-Cbl complex

    • Size exclusion chromatography to confirm oligomeric state

    • Glycosylation analysis using enzymatic deglycosylation followed by mobility shift assessment

This multi-step approach has been demonstrated to yield homogeneous, functionally active receptor protein from human placental membranes and can be adapted for recombinant rat CD320 purification with appropriate modifications .

What controls are essential when working with recombinant rat CD320 in cellular uptake experiments?

When designing cellular uptake experiments with recombinant rat CD320, the following controls are essential:

  • Negative Controls:

    • CD320 knockout cells (generated using CRISPR-Cas9 or similar gene editing approaches)

    • Competitive inhibition with excess unlabeled TC-Cbl

    • Cells expressing mutant CD320 with defective binding domains

  • Positive Controls:

    • Well-characterized cell lines with established CD320 expression (e.g., placental cell lines)

    • Human cell lines with confirmed CD320 function as cross-species reference

  • Specificity Controls:

    • Parallel uptake experiments with free cobalamin versus TC-bound cobalamin

    • Assessment of uptake in the presence of anti-CD320 blocking antibodies

    • Co-localization studies with known endocytic markers

  • Methodology Validation:

    • Time-course experiments to establish linear uptake range

    • Dose-response curves to determine saturation kinetics

    • Temperature-dependent studies (37°C vs. 4°C) to distinguish binding from internalization

Systematic inclusion of these controls ensures accurate interpretation of results and helps distinguish CD320-specific effects from background or non-specific uptake mechanisms.

How can CD320 knockout models be effectively utilized to study vitamin B12 metabolism?

CD320 knockout models represent powerful tools for investigating vitamin B12 metabolism pathways:

  • Generation Approaches:

    • ES cell-based knockout: CD320 knockout mouse embryonic stem cells (e.g., CC0426/129Ola) can be used to generate complete knockout animals

    • Conditional knockout: Recommended for tissue-specific studies, as complete knockout may produce severe phenotypes

    • CRISPR-Cas9: Enables rapid generation of rat knockout models with specific targeting of CD320

  • Essential Phenotypic Analyses:

    • Biochemical: Serum and tissue cobalamin levels, methylmalonic acid measurements

    • Hematological: Complete blood count focusing on macrocytic anemia markers

    • Neurological: Assessment of nervous system function and development

    • Immunological: Evaluation of germinal center formation and B cell function

  • Experimental Design Considerations:

    • Diet control is critical; standard vs. B12-restricted diets yield different phenotypic severity

    • Age-dependent analysis is essential as phenotypes may develop progressively

    • Tissue-specific analyses focusing on high CD320 expression sites (placenta, kidney, lymphoid tissues)

  • Rescue Experiments:

    • Reintroduction of wild-type vs. mutant CD320 constructs

    • Tissue-specific rescue to identify critical sites of action

    • Alternative pathway analysis through supplementation strategies

The methylmalonic aciduria phenotype observed in CD320 deficiency provides a clear readout for functional studies, allowing quantitative assessment of intervention effectiveness .

What is the relationship between CD320 expression patterns and disease states in experimental models?

CD320 expression exhibits significant modulation in various disease states, providing insights into potential therapeutic interventions:

  • Vitamin B12 Deficiency Models:

    • CD320 typically shows compensatory upregulation

    • Cellular distribution may shift from primarily membrane-bound to increased intracellular pools

    • Correlation between expression levels and severity of metabolic disruption

  • Inflammation and Immune Activation:

    • Significant modulation in follicular dendritic cells during germinal center reactions

    • Altered glycosylation patterns affecting receptor function

    • Potential involvement in autoimmune disease mechanisms through B cell regulation

  • Neoplastic Transformation:

    • Expression profile in rapidly dividing cells (e.g., K-562, Raji, HL-60) suggests correlation with proliferation status

    • Potential diagnostic marker in certain malignancies

    • Correlation with metabolic reprogramming in cancer cells

  • Methodology for Expression Analysis:

    • Multi-tissue Western blot arrays with standardized loading controls

    • Quantitative immunohistochemistry with digital image analysis

    • Single-cell RNA sequencing for heterogeneous tissue analysis

These expression patterns suggest CD320 may serve both as a biomarker and therapeutic target across various pathological conditions, with research design accounting for tissue-specific and disease-specific modulation .

How do post-translational modifications affect rat CD320 function and detection?

Post-translational modifications, particularly glycosylation, profoundly impact CD320 function and experimental detection:

  • Glycosylation Effects on Function:

    • N-linked glycosylation contributes significantly to the observed molecular weight discrepancy (calculated 29 kDa vs. observed 60-70 kDa)

    • These modifications are essential for proper folding, stability, and ligand binding

    • Species-specific glycosylation patterns may create subtle functional differences between rat and human CD320

  • Methodological Approaches for Analysis:

    • Enzymatic deglycosylation with PNGase F, Endo H, or O-glycosidase

    • Site-directed mutagenesis of predicted glycosylation sites

    • Lectin affinity analysis to characterize glycan structures

  • Detection Considerations:

    • Antibodies raised against peptide sequences may show variable reactivity depending on glycosylation status

    • Use of multiple antibodies targeting different epitopes is recommended

    • Denaturation conditions in sample preparation significantly impact apparent molecular weight

  • Functional Implications:

    • Tissue-specific glycosylation differences may account for variable receptor activity

    • Developmental regulation of glycosylation machinery may alter CD320 function during ontogeny

    • Pathological conditions may induce altered glycosylation affecting function

Researchers should account for these modifications when designing experiments, particularly when comparing recombinant proteins produced in different expression systems or when analyzing endogenous CD320 across different tissues .

How can researchers resolve discrepancies in apparent molecular weight of rat CD320 in experimental data?

Variations in observed molecular weight of CD320 are common and can be systematically addressed:

  • Sources of Variation:

    • Glycosylation heterogeneity (predominant cause)

    • Sample preparation conditions affecting protein denaturation

    • Gel composition and running conditions

    • Antibody specificity to different forms of the protein

  • Systematic Resolution Approach:

    • Enzymatic deglycosylation series using PNGase F (removes all N-linked glycans)

    • Parallel analysis of recombinant CD320 (with defined glycosylation) alongside endogenous protein

    • Western blot analysis using multiple antibodies targeting different epitopes

    • 2D-gel electrophoresis to separate glycoforms

  • Expected Patterns:

    • Primary bands typically observed at 60-70 kDa and 35-40 kDa

    • Complete deglycosylation should yield a band near the calculated 29 kDa size

    • Sample source affects pattern (e.g., placenta vs. cultured cells)

  • Data Interpretation:

    • Document all observed forms with molecular weight markers

    • Consider functional implications of different glycoforms

    • Relate observed patterns to specific physiological or experimental conditions

Understanding that the aberrant mobility on SDS-PAGE is primarily due to extensive complex glycosylation allows for proper experimental design and accurate interpretation of results .

What are the common pitfalls in CD320 antibody selection and how can researchers optimize detection specificity?

Antibody selection significantly impacts CD320 research outcomes and requires careful consideration:

  • Common Pitfalls:

    • Cross-reactivity with related LDL-receptor family members

    • Variable epitope accessibility due to glycosylation

    • Species specificity limitations when using human-derived antibodies on rat samples

    • Batch-to-batch variability in polyclonal antibodies

  • Optimization Strategy:

    • Validation using CD320 knockout or knockdown controls

    • Pre-adsorption tests to evaluate specificity

    • Titration series to determine optimal working concentration (typically 1:500-1:3000 for WB, 1:500-1:2000 for IHC)

    • Application-specific validation (WB conditions differ from IHC/IF requirements)

  • Application-Specific Considerations:

    • For Western blot: Sample reducing conditions affect epitope recognition

    • For IHC: Antigen retrieval method is critical (TE buffer pH 9.0 preferred; alternative: citrate buffer pH 6.0)

    • For flow cytometry: Surface vs. intracellular staining protocols yield different results

    • For IP: Binding buffers must preserve conformational epitopes

  • Recommended Validation Approach:

    • Test multiple antibodies targeting different domains

    • Include positive control tissues (placenta, kidney) in each experiment

    • Document reactivity patterns across multiple applications

    • Consider recombinant antibody technologies for improved reproducibility

These methodological considerations ensure reliable detection and minimize artifactual findings that could lead to misinterpretation of experimental results .

How should researchers interpret conflicting data between functional assays and expression levels of CD320?

Discrepancies between functional assays and expression data for CD320 are frequently encountered and require systematic investigation:

  • Potential Sources of Conflict:

    • Post-translational modifications affecting function but not detection

    • Presence of soluble forms or cleaved receptor fragments

    • Co-expression of inhibitory proteins or competitive binding partners

    • Subcellular localization differences (surface vs. intracellular pools)

  • Resolution Strategy:

    • Compartment-specific analysis (surface biotinylation, subcellular fractionation)

    • Correlation of function with specific glycoforms rather than total protein

    • Assessment of receptor saturation with endogenous transcobalamin

    • Pulse-chase experiments to determine receptor trafficking dynamics

  • Experimental Approaches:

    • Surface plasmon resonance to determine binding kinetics

    • FRET-based interaction studies to assess complex formation

    • Receptor internalization assays using labeled TC-Cbl

    • Correlation of vitamin B12 metabolic markers with receptor functionality

  • Data Integration Framework:

    • Temporal analysis distinguishing acute vs. chronic responses

    • Dose-response relationships at both expression and functional levels

    • Mathematical modeling of receptor-ligand interactions

    • Multi-parameter correlation analysis across experimental systems

By applying this systematic approach, researchers can reconcile apparent contradictions and develop more nuanced understanding of CD320 biology in both physiological and experimental contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.