Recombinant Rat CD82 antigen (Cd82)

Shipped with Ice Packs
In Stock

Description

Introduction to CD82

CD82 (Cluster of Differentiation 82), also known as KAI1 (Kangai-1), is a tetraspanin membrane protein involved in regulating cell adhesion, migration, and metastasis. While extensively studied in humans and mice, no specific studies or products explicitly mentioning "recombinant rat CD82 antigen" were identified in the provided sources. Below, we synthesize general insights into CD82’s structure, function, and recombinant applications, while highlighting gaps in rat-specific research.

Metastasis Regulation

In human RCC, CD82 overexpression reduces migration/invasion via TGF-β1/Smad pathway inhibition . Knockdown in 786-O cells increases MMP-2/9 expression, promoting metastasis .

Immune Modulation

  • Antifungal responses: CD82 clusters Dectin-1 in macrophages, enhancing Src/Syk phosphorylation and ROS production against Candida albicans .

  • Xenotransplantation: CD82 mediates human neutrophil recognition of pig endothelial cells, as shown by anti-CD82 antibody blockade .

Angiogenesis

Mouse studies show Cd82-null endothelial cells exhibit enhanced migration and invasion, contributing to pathological angiogenesis .

Recombinant Protein Applications

While rat-specific recombinant CD82 is unreported, human and mouse versions are widely used:

ApplicationHuman CD82Mouse CD82
WB/IHCDetects 30–34 kDa protein in cancer tissues Validates in mouse brain/K-562 cells
Functional StudiesLentiviral overexpression/siRNA knockdown Fungal phagosome assays
Therapeutic PotentialBiomarker for RCC prognosis Model for xenotransplantation barriers

Gaps in Rat-Specific Research

  • No direct studies: The provided sources focus on human, mouse, or pig models. Rat CD82’s role in disease remains uncharacterized.

  • Potential for future work: Rat models could explore CD82’s role in kidney disease (e.g., RCC progression) or immunology, leveraging established methodologies from human/mouse studies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your requests.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is dependent on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Cd82; Kai1; CD82 antigen; Metastasis suppressor Kangai-1 homolog; CD antigen CD82
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKSSFISVLQTSSSSLQVGAYVFI GVGAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVEVLFYFNANKLKQEMGNT VMDIIQNYSVNASSSREEAWDYVQAQVKCCGWVSPSNWTRNPVLKNSTKTTYPCSCEKTK EEDNQLIVKKGFCESDNSTASENSPEDWPVHPEGCMEKAQAWLQENFGILLGVCAGVAVI ELLGLFLSICLCRYIHSEDYSKVPKY
Uniprot No.

Target Background

Function
CD82 associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CD82 and what are its primary functions in cellular biology?

CD82 (also known as KAI1, R2, TSPAN27, SAR2, IA4, and GR15) is a tetraspanin family membrane scaffold protein that regulates cell adhesion, migration, and signaling. This protein functions primarily by:

  • Modulating integrin-mediated cellular adhesion to the extracellular matrix (ECM)

  • Regulating the organization and clustering of integrins on the cell surface

  • Altering integrin endocytosis and recycling rates

  • Contributing to tetraspanin-enriched microdomains (TEMs) formation on the plasma membrane

CD82 has been identified as a tumor suppressor that can inhibit cancer cell migration and metastasis. In hematopoietic cells, CD82 regulates hematopoietic stem/progenitor cell (HSPC) homing and adhesion to the bone marrow niche .

How does recombinant rat CD82 differ from native CD82?

Recombinant rat CD82 is produced through molecular cloning and heterologous expression systems, while native CD82 is naturally expressed in rat tissues. Key differences include:

  • Expression system: Recombinant CD82 is typically expressed in mammalian, insect, or bacterial expression systems

  • Purification tags: Recombinant proteins often contain additional sequences like His-tags or fusion proteins (e.g., mCherry-CD82 fusion proteins as described in the literature)

  • Post-translational modifications: Depending on the expression system, recombinant CD82 may have different glycosylation patterns or palmitoylation status compared to native CD82

  • Purity: Recombinant proteins are usually purified to higher homogeneity than native proteins isolated from tissues

For experimental validity, researchers should verify that their recombinant CD82 maintains the functional properties of native CD82, particularly regarding integrin interactions and membrane localization .

What are the primary experimental applications for recombinant rat CD82?

Recombinant rat CD82 serves multiple experimental purposes in research:

  • Functional studies: Investigating CD82's role in cell adhesion, migration, and signaling

  • Protein-protein interaction studies: Examining CD82's interactions with integrins (particularly α4β1) and other membrane proteins

  • Structural studies: Analyzing CD82 membrane organization and tetraspanin web formation

  • Antibody generation: Producing anti-CD82 antibodies for detection and functional blocking

  • Cell-based assays: Measuring effects on integrin expression, internalization, and recycling

In cellular models, CD82 overexpression has been shown to increase adhesion to fibronectin and laminin, while CD82 knockdown decreases adhesion to these substrates. These findings highlight CD82's importance in regulating cell-matrix interactions .

How can researchers validate the functionality of recombinant rat CD82?

To confirm that recombinant rat CD82 maintains its biological activity, researchers should perform multiple validation assays:

  • Membrane localization: Verify proper localization to the plasma membrane and endosomal compartments using confocal microscopy (consistent with the localization pattern of endogenous CD82)

  • Integrin co-localization: Confirm co-localization with α4 integrin and other binding partners using immunofluorescence techniques

  • Adhesion assays: Measure changes in cell adhesion to ECM components (especially fibronectin and laminin) following CD82 expression

  • Integrin surface expression: Quantify surface expression of α2, α4, and α6 integrins using flow cytometry, as CD82 has been shown to specifically increase α2 and α4 expression

  • Integrin internalization and recycling: Assess the impact on integrin trafficking using fluorescence-quenching internalization assays

Proper validation should include appropriate positive and negative controls, including CD82 knockdown cells and cells expressing palmitoylation-deficient CD82 mutants (Palm-CD82) .

How does CD82 regulate integrin clustering and molecular organization?

CD82 plays a critical role in regulating the nanoscale organization of integrins, particularly α4β1, which influences cell adhesion strength:

  • Cluster density modulation: CD82 increases the molecular packing density of α4 integrin within nanoscale clusters, as revealed by super-resolution microscopy techniques like direct stochastic optical reconstruction microscopy (dSTORM)

  • Tetraspanin-enriched microdomains (TEMs): CD82 contributes to the formation of specialized membrane domains that organize and stabilize integrins

  • Palmitoylation dependence: The ability of CD82 to regulate integrin clustering partially depends on its palmitoylation status, as palmitoylation-deficient CD82 mutants (Palm-CD82) show altered effects on integrin organization

  • Lipid raft association: CD82 may facilitate integrin association with lipid rafts, further stabilizing integrin clusters and enhancing signaling

This nanoscale organization of integrins directly impacts the strength of cell adhesion to the extracellular matrix and influences downstream signaling pathways .

What mechanisms underlie CD82-mediated regulation of integrin expression?

CD82 regulates integrin surface expression through multiple mechanisms:

  • Endocytosis inhibition: CD82 overexpression reduces the internalization rate of α4 integrin, as demonstrated by fluorescence-quenching internalization assays

  • Enhanced recycling: CD82 increases the recycling rate of internalized α4 integrin back to the plasma membrane

  • Protein stabilization: CD82 may stabilize mature integrins, as Western blot analysis shows increased mature and immature forms of α4 in CD82-overexpressing cells (approximately 20% increase in mature α4)

  • Selective integrin regulation: CD82 specifically increases α2 and α4 integrin surface expression while potentially decreasing α6 levels, suggesting selective regulatory mechanisms

  • Post-translational regulation: CD82 does not appear to affect α4 mRNA levels but rather regulates protein processing and trafficking

Together, these mechanisms contribute to increased α4β1 integrin availability at the cell surface, enhancing cell adhesion to fibronectin and VCAM-1 .

What expression systems are optimal for producing functional recombinant rat CD82?

When selecting an expression system for recombinant rat CD82, researchers should consider:

  • Mammalian expression systems (preferred):

    • HEK293 or CHO cells provide proper post-translational modifications

    • Single plasmid systems using FMDV 2A self-processing peptide can express both heavy and light chains from a single open reading frame

    • Transient transfection allows for rapid production

  • Key considerations for functional expression:

    • Preservation of palmitoylation sites, as these affect CD82 function

    • Proper membrane targeting sequences

    • Selection of appropriate fusion tags (N-terminal tags like mCherry have been successfully used)

    • Expression level control to avoid aggregation

  • Purification strategies:

    • Detergent-based membrane protein extraction

    • Affinity chromatography using fusion tags

    • Size exclusion chromatography for final purification

For studying CD82 in cellular contexts, creating stable cell lines with controlled expression levels is often preferable to purified protein approaches .

What antibody-based detection methods are most effective for rat CD82 in experimental settings?

For effective detection of rat CD82 in research applications, consider these antibody-based approaches:

  • Flow cytometry:

    • Detects surface expression levels of CD82

    • Can quantitatively measure changes in expression following experimental manipulations

    • Useful for correlating CD82 levels with integrin expression

  • Western blotting:

    • Distinguishes between mature and immature forms of CD82

    • Can detect total cellular CD82 expression

    • Useful for validation of knockdown or overexpression systems

  • Immunofluorescence microscopy:

    • Visualizes CD82 localization within cells

    • Can be combined with integrin staining to assess co-localization

    • Super-resolution techniques (dSTORM) enable analysis of nanoscale organization

  • Recombinant antibody selection:

    • Monoclonal antibodies provide consistent results across experiments

    • Consider using high-throughput selection methods to identify specific anti-CD82 antibodies

    • Validate antibody specificity using CD82 knockout controls

When selecting antibodies, verify cross-reactivity with rat CD82, as many commercially available antibodies may be optimized for human or mouse CD82 .

How can researchers accurately measure CD82-mediated effects on integrin trafficking?

Measuring CD82's impact on integrin trafficking requires specialized techniques:

  • Fluorescence-quenching internalization assay:

    • Label surface α4 integrin with Alexa 488-conjugated antibodies at 4°C

    • Allow internalization at 37°C for various time points

    • Quench remaining surface fluorescence with anti-Alexa 488 antibodies

    • Quantify internalized integrin by flow cytometry

  • Recycling assay:

    • Follow internalization protocol as above

    • Return cells to 37°C to allow recycling

    • Measure reappearance of fluorescence at the cell surface

    • Calculate recycling rate as percentage of internalized integrin returning to surface

  • Biotinylation-based trafficking assays:

    • Label surface proteins with cleavable biotin

    • Allow internalization

    • Remove remaining surface biotin with reducing agent

    • Detect internalized biotinylated integrins by Western blotting

  • Live-cell imaging:

    • Use fluorescently tagged integrins to track movement in real-time

    • Quantify trafficking rates and routes using particle tracking software

When designing these experiments, include appropriate controls such as CD82 overexpression, CD82 knockdown, and palmitoylation-deficient CD82 mutants to comprehensively evaluate CD82's role in integrin trafficking .

What analytical approaches best characterize the interaction between CD82 and integrins?

To characterize CD82-integrin interactions, consider these analytical approaches:

  • Co-immunoprecipitation studies:

    • May not detect direct interactions between CD82 and integrins

    • Previous studies have been unable to detect direct interaction between CD82 and α4 via immunoprecipitation

    • Useful for identifying components of larger protein complexes

  • Proximity ligation assays (PLA):

    • Detect proteins within 40 nm of each other

    • Provide spatial information about potential interactions

    • Can be performed in intact cells

  • Fluorescence resonance energy transfer (FRET):

    • Measures protein interactions within 10 nm

    • Can be performed in living cells

    • Requires careful control experiments

  • Super-resolution microscopy:

    • dSTORM analysis evaluates nanoscale clustering of CD82 and integrins

    • Can measure how CD82 regulates integrin organization

    • Useful for correlating molecular organization with functional outcomes

  • Functional blocking assays:

    • Use specific blocking peptides (e.g., LDV peptide for α4β1)

    • Determine if CD82-mediated effects depend on specific integrins

    • Adhesion to specific substrates (fibronectin, VCAM-1) can reveal integrin involvement

These approaches collectively provide complementary information about how CD82 influences integrin behavior, even in the absence of direct molecular interactions .

What are common challenges in working with recombinant rat CD82 and how can they be addressed?

Researchers working with recombinant rat CD82 frequently encounter these challenges:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Use strong promoters suitable for membrane proteins

    • Consider inducible expression systems to reduce toxicity

    • Test different signal sequences to improve membrane targeting

  • Improper folding and aggregation:

    • Lower expression temperature (28-30°C instead of 37°C)

    • Include chemical chaperones in the culture medium

    • Use fusion partners known to enhance solubility

    • Ensure expression system supports proper post-translational modifications

  • Functional validation difficulties:

    • Use multiple complementary assays to confirm functionality

    • Include positive controls (native CD82) and negative controls (CD82 knockdown)

    • Verify membrane localization before proceeding to functional assays

    • Test functionality in physiologically relevant cell types

  • Antibody specificity issues:

    • Validate antibodies against overexpression and knockdown samples

    • Consider developing custom antibodies if commercial options lack specificity

    • Use recombinant antibody selection methods to identify high-specificity clones

  • Lipid environment requirements:

    • Ensure preservation of tetraspanin-enriched microdomains

    • Consider supplementing with specific lipids if using artificial membrane systems

    • Be cautious with detergent selection during extraction and purification

Systematic optimization of these parameters can significantly improve experimental outcomes when working with recombinant rat CD82 .

How should experimental design be modified when studying palmitoylation-dependent functions of CD82?

When investigating palmitoylation-dependent functions of CD82, consider these experimental design modifications:

  • Generation of palmitoylation mutants:

    • Create Palm-CD82 mutants by replacing cysteine residues at palmitoylation sites with alanine

    • Verify loss of palmitoylation using metabolic labeling with palmitic acid analogs

    • Include both wild-type CD82 and Palm-CD82 in all experiments

  • Palmitoylation detection methods:

    • Metabolic labeling with alkyne-palmitate followed by click chemistry

    • Acyl-biotin exchange (ABE) assay to detect protein S-palmitoylation

    • Mass spectrometry to identify specific palmitoylation sites

  • Functional assays to detect palmitoylation-dependent effects:

    • Compare wild-type and Palm-CD82 in adhesion assays to fibronectin and laminin

    • Analyze differences in integrin clustering using super-resolution microscopy

    • Assess lipid raft association using detergent resistance assays

    • Evaluate protein-protein interactions using proximity-based assays

  • Trafficking analysis:

    • Determine if palmitoylation affects CD82 localization to tetraspanin-enriched microdomains

    • Compare internalization and recycling rates between wild-type and Palm-CD82

    • Analyze endosomal sorting using co-localization with endosomal markers

  • Palmitoylation inhibitor studies:

    • Use 2-bromopalmitate or other palmitoylation inhibitors as complementary approaches

    • Include appropriate vehicle controls

    • Monitor potential off-target effects on other palmitoylated proteins

Research has shown that while palmitoylation affects some CD82 functions, certain processes like integrin internalization remain unaffected by palmitoylation status, highlighting the importance of comprehensive experimental design .

How does CD82 function change across different cell types and physiological contexts?

CD82 exhibits context-dependent functions across different cell types:

  • Hematopoietic stem/progenitor cells (HSPCs):

    • Regulates homing to the bone marrow and retention in the niche

    • Mediates adhesion to osteoblasts through integrin modulation

    • Affects HSPC mobilization in response to cytokines

    • Monoclonal antibodies against CD82 can inhibit HSPC homing to bone marrow

  • Cancer cells:

    • Functions as a metastasis suppressor (KAI1)

    • Downregulation correlates with increased metastatic potential

    • May inhibit cell motility through effects on integrin trafficking

    • Potentially modulates growth factor receptor signaling

  • Immune cells:

    • May regulate immune synapse formation and T cell activation

    • Affects antigen-presenting cell interactions

    • Potentially modulates immunological memory formation

  • Neural cells:

    • Expression patterns change during neural development

    • May influence neural migration and axonal pathfinding

These diverse functions highlight the importance of studying CD82 in physiologically relevant cell types and experimental systems. Researchers should carefully consider the cellular context when interpreting results and designing experiments .

What emerging technologies offer new insights into CD82 structure and function?

Several cutting-edge technologies are advancing our understanding of CD82:

  • Super-resolution microscopy techniques:

    • Direct stochastic optical reconstruction microscopy (dSTORM) reveals nanoscale organization of CD82 and integrins

    • Single-molecule localization microscopy tracks individual CD82 molecules

    • Stimulated emission depletion (STED) microscopy provides high-resolution imaging of CD82 in membrane microdomains

  • Cryo-electron microscopy:

    • May reveal the structural basis of CD82-mediated tetraspanin web formation

    • Could elucidate interactions with partner proteins in membrane environments

  • CRISPR-based approaches:

    • CRISPR activation/interference systems for precisely controlling CD82 expression

    • Base editing for introducing specific mutations in endogenous CD82

    • CRISPR screens to identify novel CD82 interaction partners

  • Single-cell technologies:

    • Single-cell RNA-seq to map CD82 expression patterns across tissues

    • Mass cytometry for high-dimensional analysis of CD82 in heterogeneous cell populations

    • Single-cell proteomics to correlate CD82 levels with integrated signaling networks

  • Advanced recombinant antibody technologies:

    • High-throughput selection of recombinant antibodies against specific CD82 epitopes

    • Single-plasmid expression systems for rapid antibody production

    • Multiplex immunization strategies for generating diverse antibody panels

These technologies provide unprecedented resolution and throughput for studying CD82 biology and will likely yield important new insights into its functions and regulatory mechanisms .

What are the most significant unresolved questions about rat CD82 function?

Despite advances in CD82 research, several important questions remain:

  • Molecular interaction mechanisms:

    • How does CD82 regulate integrin clustering without direct binding?

    • What intermediary molecules facilitate CD82-integrin functional interactions?

    • How do tetraspanin-enriched microdomains organize to regulate adhesion?

  • Signaling pathway integration:

    • How does CD82 integrate with intracellular signaling networks?

    • What are the downstream effectors of CD82-mediated adhesion changes?

    • How does CD82 interact with other tetraspanins to form functional complexes?

  • Physiological and pathological roles:

    • What is the precise role of CD82 in HSPC homing and maintenance?

    • How do alterations in CD82 expression contribute to disease states?

    • Can CD82 be therapeutically targeted in cancer or immune disorders?

  • Structural determinants of function:

    • Which domains of CD82 are critical for specific functions?

    • How do post-translational modifications beyond palmitoylation affect CD82?

    • What is the three-dimensional structure of CD82 in membrane environments?

Addressing these questions will require interdisciplinary approaches combining molecular biology, advanced imaging, proteomics, and in vivo models .

How might recombinant rat CD82 be utilized in therapeutic applications?

Potential therapeutic applications for recombinant rat CD82 include:

  • Cancer therapy development:

    • As a tumor suppressor, CD82 restoration could potentially inhibit metastasis

    • CD82-derived peptides might target specific metastasis-promoting pathways

    • Understanding CD82's role in integrin organization could inform development of anti-metastatic drugs

  • Stem cell mobilization and homing:

    • Anti-CD82 antibodies have been shown to inhibit HSPC homing to bone marrow

    • Modulating CD82 function could potentially enhance stem cell collection for transplantation

    • CD82-targeting strategies might improve stem cell engraftment in therapeutic contexts

  • Research tool applications:

    • Recombinant antibodies against CD82 can be used to study adhesion mechanisms

    • CD82 expression systems provide models for studying tetraspanin function

    • Integration of CD82 into artificial membrane systems could create advanced in vitro models

  • Diagnostic applications:

    • CD82 expression patterns may serve as biomarkers in certain cancers

    • Anti-CD82 antibodies could be developed for imaging and diagnostic applications

    • Monitoring CD82 modifications may provide insights into disease progression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.