Recombinant Rat CDGSH iron-sulfur domain-containing protein 1 (Cisd1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rat CDGSH Iron-Sulfur Domain-Containing Protein 1 (CISD1), also known as mitoNEET in humans, is a mitochondrial outer membrane protein involved in iron-sulfur (Fe-S) cluster coordination and redox regulation. Produced via recombinant DNA technology, this protein enables researchers to study its role in mitochondrial function, metabolic diseases, and neurodegenerative disorders .

Mitochondrial Redox Regulation

CISD1 modulates mitochondrial electron transport and redox balance by transferring its [2Fe-2S] cluster to acceptor proteins . Loss of the Fe-S cluster promotes dimerization, implicated in Parkinson’s disease (PD) pathophysiology .

Neuroprotection and Autophagy

In rat models of hypoxic-ischemic (HI) brain injury, CISD1 overexpression:

  • Reduces ROS production by 40–60% .

  • Inhibits autophagosome formation (LC3-II levels decrease by ~50%) .

  • Improves neuronal survival and mitochondrial membrane potential .

Disease Modeling

  • Parkinson’s Disease: CISD1 dimerization is elevated in PINK1 mutant dopaminergic neurons, correlating with mitochondrial fragmentation and oxidative stress .

  • Metabolic Disorders: Cisd1 knockout in C. elegans lowers glucose uptake by 30%, highlighting its role in energy metabolism .

Experimental Tools

  • ELISA Kits: Detect native CISD1 in rat tissues (sensitivity: <0.054 ng/mL; linear range: 0.156–10 ng/mL) .

  • Recombinant Protein: Used in structural studies (e.g., crystallography with sulfonamide ligands) and in vitro autophagy assays .

Key Research Findings

Study ModelKey OutcomeCitation
Rat Cortical NeuronsCISD1 overexpression reduces infarct volume by 35% in HI injury
Drosophila PD ModelsCisd knockout rescues lifespan and motor deficits in Pink1 mutants
C. eleganscisd-1 mutants exhibit 20% lower ATP levels and mitochondrial fragmentation

Detection and Quantification

Rat CISD1 ELISA Kit (MBS2025586)

  • Specificity: No cross-reactivity with analogues .

  • Precision: Intra-assay CV <10%, inter-assay CV <12% .

  • Applications: Tissue homogenates, cell lysates, and biological fluids .

Future Directions

Recent studies propose CISD1 as a therapeutic target for PD, with iron-depleted dimers driving neurodegeneration . Ongoing research focuses on:

  • Small-molecule inhibitors to prevent pathological dimerization .

  • Gene therapy approaches to restore Fe-S cluster stability .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Cisd1; CDGSH iron-sulfur domain-containing protein 1; MitoNEET
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-108
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Cisd1
Target Protein Sequence
GLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET
Uniprot No.

Target Background

Function
Plays a key role in regulating the maximal capacity for electron transport and oxidative phosphorylation. May be involved in Fe-S cluster shuttling and/or redox reactions.
Gene References Into Functions
  1. MicroRNA-127 targets mitoNEET, which inhibits neurite outgrowth, induces cell apoptosis, and contributes to physiological dysfunction after spinal cord transection PMID: 27748416
  2. mito- NEET is an important iron-containing protein involved in the control of maximal mitochondrial respiratory rates [mitoNEET] PMID: 17376863
  3. mitoNEET is located in the mitochondrial fraction of rat brain, liver, and skeletal muscle. PMID: 14570702
  4. Describes methods for isolating mitochondrial membrane fractions enriched in mitoNEET, generating constructs for the expression of recombinant mitoNEET protein, and analyzing the 2Fe-2S cluster of mitoNEET in vitro PMID: 19348892
Database Links
Protein Families
CISD protein family
Subcellular Location
Mitochondrion outer membrane; Single-pass type III membrane protein.

Q&A

Basic Research Questions

  • What is CISD1 and what is its functional significance in rat models?

    CISD1 (CDGSH iron sulfur domain 1) is a protein containing a unique 39 amino acid CDGSH domain [C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H] that binds a redox-active [2Fe-2S] cluster . This protein, also called mitoNEET, is an integral membrane protein localized to the outer mitochondrial membrane and is hypothesized to regulate iron transport into mitochondria, which is essential for the function of several mitochondrial enzymes . Rat CISD1 serves as an important model for studying mitochondrial iron metabolism and redox regulation due to its structural and functional similarity to the human ortholog. Understanding rat CISD1 provides insights into fundamental mechanisms of iron homeostasis and oxidative stress that can be translated to human studies.

  • How does rat CISD1 structurally compare to human CISD1?

    Rat CISD1 shares considerable sequence homology with its human counterpart, particularly in the conserved CDGSH iron-sulfur binding domain. Both proteins contain the characteristic [2Fe-2S] cluster and form similar three-dimensional structures. The human CISD1 gene is located on chromosome 10 q21.3 , while the rat ortholog maintains comparable structural features. This conservation extends to the protein's molecular weight, with human CISD1 at approximately 12.2 kDa and rat CISD1 exhibiting similar mass. The high degree of conservation between species suggests that findings from rat models regarding CISD1 function can be reasonably extrapolated to human physiology, making rat CISD1 a valuable research tool.

  • What tissue distribution patterns does CISD1 exhibit in rat models?

    While specific CISD1 distribution data is limited in the search results, we can draw parallels with other conserved proteins. Studies of cystatin C, another well-characterized protein, demonstrate that different rat tissues contain varying levels of protein expression, with brain tissue showing the highest content and liver the lowest, while kidney, spleen, and muscle tissues display intermediate content . Based on its mitochondrial localization, CISD1 is likely to show elevated expression in tissues with high metabolic demands. When investigating tissue-specific expression patterns of rat CISD1, researchers should consider employing sensitive detection methods like the ELISA kit described in the literature, which has a detection range of 0.156-10 ng/mL and sensitivity below 0.054 ng/mL .

Advanced Research Questions

  • What expression systems and conditions optimize recombinant rat CISD1 production?

    Escherichia coli represents a viable expression system for recombinant CISD1 production, as demonstrated with other iron-sulfur proteins . When designing an expression strategy, researchers should consider:

    Expression ParameterRecommended ConditionsRationale
    Expression vectorpET-based with N-terminal His-tagFacilitates purification while minimizing interference with [2Fe-2S] cluster binding
    E. coli strainBL21(DE3) or Rosetta(DE3)Enhanced expression of eukaryotic proteins
    Growth temperature18-25°C after inductionPromotes proper folding and iron-sulfur cluster incorporation
    Induction conditions0.1-0.5 mM IPTG, OD600 0.6-0.8Balances protein yield with proper folding
    Supplementation50-100 μM ferrous ammonium sulfateEnsures adequate iron for cluster assembly

    Post-induction cultures should be grown under microaerobic conditions to protect the oxygen-sensitive [2Fe-2S] cluster. Extraction buffers should contain reducing agents to maintain cluster integrity.

  • How can researchers accurately characterize the redox properties of the [2Fe-2S] cluster in rat CISD1?

    The [2Fe-2S] cluster in CISD1 is a critical functional element that contributes to the protein's redox activity . For comprehensive characterization, researchers should employ multiple complementary techniques:

    • UV-visible spectroscopy: Purified rat CISD1 typically exhibits characteristic absorption peaks at approximately 330-340 nm, 420-430 nm, and 550-560 nm, indicative of the [2Fe-2S] cluster. Spectral changes during titration with oxidants/reductants can determine redox potential.

    • Electron paramagnetic resonance (EPR): This technique detects paramagnetic species, allowing monitoring of the cluster's oxidation state transitions. The reduced [2Fe-2S] cluster should give a characteristic g = 1.94 signal.

    • Protein film electrochemistry: By immobilizing CISD1 on an electrode surface, direct measurement of electron transfer to/from the cluster can determine precise redox potentials.

    • Circular dichroism (CD) spectroscopy: Near-infrared CD spectra provide information about the cluster environment and can detect subtle changes upon ligand binding or mutation.

  • What methodologies can elucidate CISD1's role in mitochondrial function and disease models?

    To investigate rat CISD1's role in mitochondrial biology and pathophysiology, researchers can implement a multi-faceted approach:

    • CRISPR-Cas9 genome editing: Generate CISD1-knockout or specific point mutants in rat cell lines to assess effects on mitochondrial parameters such as membrane potential, respiratory capacity, and ROS production.

    • Mitochondrial isolation and respirometry: Compare oxygen consumption rates and respiratory complex activities between wild-type and CISD1-deficient mitochondria using platforms like Seahorse XF or Oroboros O2k.

    • Fluorescence microscopy with specific probes: Utilize MitoTracker, TMRM, or mitochondria-targeted roGFP to assess mitochondrial morphology, potential, and redox state in relation to CISD1 manipulation.

    • Metabolomics: Apply LC-MS/MS to identify metabolic pathways affected by CISD1 alteration, particularly focusing on iron-dependent processes.

    • Disease model integration: In rat models of diabetes, researchers should investigate CISD1 in light of evidence that the antidiabetic drug pioglitazone binds to mitoNEET with affinity comparable to its interaction with PPAR .

Methodological Questions

  • What purification strategies yield functional recombinant rat CISD1?

    Purification of recombinant rat CISD1 with intact [2Fe-2S] clusters requires careful consideration of buffer conditions and chromatographic techniques:

    Purification StepMethodBuffer ConditionsNotes
    Initial captureImmobilized metal affinity chromatography (IMAC)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 5 mM β-mercaptoethanolFor His-tagged CISD1; include 5-20 mM imidazole to reduce non-specific binding
    Intermediate purificationIon exchange chromatography20 mM HEPES pH 7.5, 50-500 mM NaCl gradient, 5 mM DTTSeparates based on surface charge distribution
    PolishingSize exclusion chromatography25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTTResolves dimeric CISD1 from aggregates and contaminants

    Throughout purification, buffers should be degassed and, ideally, procedures performed under anaerobic conditions to preserve the oxygen-sensitive [2Fe-2S] cluster. The final purified protein should have a characteristic brownish color, indicating intact iron-sulfur clusters.

  • What detection methods and antibodies are most effective for rat CISD1 analysis?

    For reliable detection of rat CISD1 in various experimental contexts, researchers have several validated options:

    • ELISA: Commercial rat CISD1 ELISA kits provide high sensitivity (< 0.054 ng/mL) and specificity for quantitative analysis in tissue homogenates and cell lysates . These kits employ a double-antibody sandwich approach with biotin-conjugated antibodies specific to CISD1.

    • Western blotting: When selecting antibodies for immunoblotting, researchers should prioritize those raised against conserved epitopes within the CDGSH domain to ensure specificity. Protocol optimization should include proper reducing conditions to maintain protein structure.

    • Immunohistochemistry: For tissue section analysis, commercially available antibodies have been validated for detecting CISD1 in rat tissues . These can identify the subcellular localization patterns of CISD1, particularly its association with mitochondria.

    • Mass spectrometry: For unbiased detection and quantification, targeted proteomics approaches like selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) offer high specificity without antibody dependence.

  • How can researchers assess functional interactions between rat CISD1 and potential binding partners?

    To characterize interactions between rat CISD1 and its partners (such as pioglitazone ), researchers should employ complementary biophysical and functional approaches:

    • Isothermal titration calorimetry (ITC): Provides thermodynamic parameters (ΔH, ΔS, Kd) of binding between purified CISD1 and ligands under various conditions.

    • Surface plasmon resonance (SPR): Enables real-time measurement of association and dissociation kinetics between immobilized CISD1 and flowing analytes.

    • Differential scanning fluorimetry: Thermal shift assays can detect ligand-induced stabilization of CISD1's protein structure, indicating binding.

    • Crystallography and NMR spectroscopy: These techniques provide atomic-level details of the interaction interface between CISD1 and binding partners.

    • Functional assays: Researchers should assess how ligand binding affects the redox properties of CISD1's [2Fe-2S] cluster and its iron transfer capabilities using spectroscopic methods.

  • What experimental approaches can determine CISD1's role in iron homeostasis and redox regulation?

    Investigating CISD1's involvement in iron metabolism and redox processes requires specialized techniques:

    • Iron binding and transfer assays: Using purified recombinant rat CISD1, researchers can employ spectroscopic methods to monitor changes in the [2Fe-2S] cluster during interaction with iron acceptor proteins.

    • Liposome reconstitution experiments: Incorporation of purified CISD1 into liposomes allows measurement of iron transport across membranes using iron-sensitive fluorescent probes or radiolabeled iron (55Fe).

    • Cellular iron quantification: Comparing iron content in subcellular fractions between wild-type and CISD1-manipulated cells using inductively coupled plasma mass spectrometry (ICP-MS) can reveal CISD1's influence on iron distribution.

    • Redox proteomics: Differential alkylation approaches can identify redox-sensitive proteins affected by CISD1 manipulation, providing insights into its redox regulatory network.

    • In vivo models: Transgenic rat models with CISD1 modifications can be assessed for alterations in systemic and tissue-specific iron parameters, connecting molecular functions to physiological outcomes.

Specialized Applications

  • How can CISD1 be utilized as a therapeutic target in metabolic disease models?

    Based on CISD1's interaction with the antidiabetic drug pioglitazone , researchers investigating its therapeutic potential should:

    • Perform structure-activity relationship studies: Using recombinant rat CISD1, screen chemical libraries to identify compounds that modulate its [2Fe-2S] cluster stability or redox potential.

    • Develop cell-based reporter assays: Create fluorescent or luminescent readouts that reflect CISD1 activity to enable high-throughput screening.

    • Evaluate tissue-specific effects: Since mitochondrial function varies by tissue type, assess CISD1-targeting compounds in multiple cell types relevant to metabolic diseases.

    • Integrate with disease models: Test CISD1 modulators in established rat models of diabetes, obesity, or mitochondrial dysfunction, evaluating both efficacy and mechanism.

    • Consider combination approaches: Investigate potential synergies between CISD1-targeting compounds and established therapies for metabolic diseases.

  • What considerations are important when comparing results between recombinant and endogenous rat CISD1?

    Researchers should be mindful of several factors when extrapolating from studies using recombinant protein to endogenous CISD1 function:

    • Post-translational modifications: Endogenous rat CISD1 may undergo modifications absent in recombinant protein expressed in bacterial systems.

    • Protein-protein interactions: The mitochondrial membrane environment provides specific interaction partners that may alter CISD1 function compared to isolated recombinant protein.

    • Concentration effects: Recombinant protein studies often use higher concentrations than physiological levels, potentially affecting reaction kinetics and equilibria.

    • Redox environment: The cellular redox environment differs significantly from in vitro conditions, potentially affecting the [2Fe-2S] cluster state.

    • Validation approaches: When possible, researchers should confirm findings from recombinant protein studies using approaches that examine endogenous CISD1 in cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.