Recombinant Rat Cell cycle control protein 50A (Tmem30a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem30a; Cdc50a; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-328
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
AMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKEC EPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFR NPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYR LIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGS ISFLLGVVLLVINHKYRNSSNTADITI
Uniprot No.

Target Background

Function

TMEM30A is an accessory component of a P4-ATPase flippase complex. This complex catalyzes ATP hydrolysis, coupled with the transport of aminophospholipids from the outer to the inner leaflet of various membranes. This process maintains the asymmetric distribution of phospholipids. Phospholipid translocation is also implicated in vesicle formation and the uptake of lipid signaling molecules. The beta subunit (TMEM30A) may assist in phospholipid substrate binding. TMEM30A is required for the proper folding, assembly, and ER-to-Golgi transport of the ATP8A2:TMEM30A flippase complex. The ATP8A2:TMEM30A complex may regulate neurite outgrowth and, when reconstituted into liposomes, predominantly transports phosphatidylserine (PS) and, to a lesser extent, phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex appears to regulate cell migration, likely through flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. TMEM30A is also required for the formation of intermediate phosphoenzymes of the ATP8A2, ATP8B1, and ATP8B2 P-type ATPases. It is involved in platelet-activating factor (PAF) uptake and may mediate the export of alpha subunits (ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B, and ATP11C) from the ER to other membrane locations.

Database Links
Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus. Cytoplasmic vesicle, secretory vesicle membrane. Apical cell membrane. Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is TMEM30A and what are its primary functions in rat models?

TMEM30A (Transmembrane Protein 30A), also known as CDC50A or cell cycle control protein 50A, functions as an essential β subunit of P4-ATPase flippases. In rat models, it serves several critical functions:

  • Maintains phospholipid asymmetry across cell membranes by facilitating P4-ATPase flippase activity

  • Regulates clathrin-mediated vesicle transport between the trans-Golgi network and plasma membrane

  • Plays essential roles in multiple tissue systems including neural tissue, retina, liver, and hematopoietic cells

  • Supports insulin maturation and secretion in pancreatic β cells

The rat TMEM30A protein consists of 328 amino acids with two transmembrane domains and has high sequence homology with human TMEM30A .

What are the optimal storage and handling conditions for recombinant rat TMEM30A?

For maximum stability and activity preservation:

Storage ConditionRecommendationNotes
Long-term storage-20°C to -80°CFor extended storage, -80°C is preferred
Working aliquots4°CUp to one week
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Freeze-thaw cyclesAvoid repeated cyclesCreate single-use aliquots

For lyophilized form, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for aliquoting and long-term storage .

How can researchers validate the functional activity of recombinant rat TMEM30A in experimental systems?

Functional validation requires assessment of TMEM30A's key activities:

Phospholipid flippase activity assay:

  • Co-express recombinant TMEM30A with its P4-ATPase partners (ATP8A1, ATP8A2, or ATP11C) in a cell line with low endogenous expression

  • Label outer membrane leaflet with fluorescent PS analogs (NBD-PS) or other aminophospholipids

  • Measure internalization rates using flow cytometry or fluorescence microscopy

  • Compare flippase activity to control cells without recombinant TMEM30A expression

P4-ATPase complex formation assessment:

  • Perform co-immunoprecipitation studies with tagged TMEM30A and its P4-ATPase partners

  • Examine glycosylation patterns of TMEM30A using Western blotting

  • Assess for higher-molecular-weight banding, indicating proper post-translational modification

A functional recombinant TMEM30A should show:

  • Successful heterodimerization with P4-ATPases

  • Proper glycosylation patterns

  • Enhanced phospholipid translocation compared to controls

What are the specific considerations for using recombinant rat TMEM30A in knockout/knockdown rescue experiments?

When designing rescue experiments with recombinant TMEM30A:

Critical design considerations:

  • Create shRNA-resistant TMEM30A constructs:

    • Introduce silent mutations in the shRNA target region to prevent knockdown of the rescue construct

    • Validate expression levels using RT-PCR and Western blot to ensure comparable expression to endogenous levels

  • Evaluate restoration of key cellular processes:

    • In pancreatic β cells: Assess insulin secretion and glucose sensing (Glut2 trafficking)

    • In podocytes: Measure expression of podocyte markers (WT1, Synaptopodin) and glycolysis-related molecules (ALDOA, HK2, LDHA, GAPDH)

    • In B cells: Evaluate BCR mobility and signaling using single-particle tracking techniques

  • Functional rescue assessment:
    Research shows that resTmem30a (shRNA-resistant TMEM30A) can partially reverse phenotypic changes in TMEM30A-knockdown cells, with specific improvements in:

    • Expression of glycolysis-related proteins (1.7-2.5 fold increase)

    • Restoration of podocyte-specific markers (approximately 2-fold increase)

    • Normalization of vesicular transport functions

  • Controls to include:

    • Wild-type cells (positive control)

    • TMEM30A knockdown/knockout cells (negative control)

    • Cells expressing non-functional TMEM30A mutants

How does recombinant rat TMEM30A interact with different P4-ATPase partners, and how can these interactions be optimized in experimental systems?

TMEM30A forms functional complexes with multiple P4-ATPases, with distinct interaction patterns:

P4-ATPase PartnerInteraction StrengthCellular LocalizationPrimary Function
ATP8A1High affinityPlasma membrane, recycling endosomesCell migration and membrane stability
ATP8A2High affinityPhotoreceptor cells, neuronsNeurite outgrowth, photoreceptor function
ATP8B1Moderate affinityCanalicular membrane (liver)Bile acid transport
ATP11CHigh affinityPlasma membrane, early endosomesB-cell development, erythrocyte formation

Optimization strategies:

  • Co-expression optimization:

    • Use bicistronic expression vectors ensuring equimolar expression

    • Verify co-localization using confocal microscopy with differentially tagged proteins

    • Optimize expression timing, as some P4-ATPases may require longer maturation periods

  • Complexation enhancement:

    • Include glycosylation site preservatives in expression systems

    • Maintain optimal pH (7.2-7.4) and calcium levels for complex formation

    • Consider membrane cholesterol content, which affects complex stability

  • Activity assessment:

    • Measure ATPase activity using colorimetric phosphate release assays

    • Perform lipid translocation assays with specific substrates for each P4-ATPase

    • Compare activity ratios between different P4-ATPase partners to determine specificity

What are the most effective systems for expressing and purifying functional recombinant rat TMEM30A?

Based on research protocols for membrane proteins:

Expression systems comparison:

Expression SystemAdvantagesLimitationsYield
E. coliLow cost, rapid growth, high yieldLimited post-translational modifications, inclusion body formation1-5 mg/L
Insect cellsBetter folding, some post-translational modificationsModerate cost, longer expression time0.5-2 mg/L
Mammalian cellsNative-like modifications, proper foldingHigher cost, lower yield, longer expression time0.1-1 mg/L
Yeast (P. pastoris)High yield, glycosylation capability, cost-effectiveGlycosylation patterns differ from mammals0.5-3 mg/L

Purification protocol recommendations:

  • For E. coli expression:

    • Include solubilization steps with mild detergents (DDM, CHAPS)

    • Consider fusion partners (MBP, GST) to enhance solubility

    • Implement refolding protocols if inclusion bodies form

  • For eukaryotic expression systems:

    • Use affinity tags that don't interfere with transmembrane regions

    • Employ gentle extraction with digitonin or other amphipathic detergents

    • Consider nanodiscs or amphipols for maintaining native conformation

  • Quality control metrics:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to assess secondary structure

    • Functional assays for phospholipid translocation activity

How can researchers effectively study TMEM30A-mediated phospholipid flippase activity in different experimental contexts?

Methodological approaches for measuring flippase activity:

  • Fluorescent lipid translocation assays:

    • Label cells with fluorescent phospholipid analogs (NBD-PS, NBD-PE)

    • Monitor internalization rates using flow cytometry or fluorescence microscopy

    • Quantify by back-extraction with BSA or by fluorescence quenching techniques

    • Calculate translocation rates and compare between experimental conditions

  • Mass spectrometry-based approaches:

    • Use heavy isotope-labeled phospholipids to track translocation

    • Isolate membrane fractions at different time points

    • Quantify labeled phospholipid distribution between inner and outer leaflets

    • Provides absolute quantification of specific phospholipid species

  • Biochemical ATPase activity assays:

    • Measure ATP hydrolysis rates of purified TMEM30A-P4-ATPase complexes

    • Use colorimetric assays (malachite green) to quantify phosphate release

    • Test lipid-dependence by adding different phospholipid substrates

    • Compare activity between wild-type and mutant forms

  • Live-cell imaging approaches:

    • Express fluorescently tagged TMEM30A and P4-ATPases

    • Monitor subcellular localization and trafficking

    • Use FRET-based sensors to detect protein-protein interactions

    • Correlate localization patterns with flippase activity

What experimental approaches can assess the role of recombinant rat TMEM30A in vesicular transport pathways?

To study TMEM30A's function in vesicular transport:

  • Live-cell vesicle tracking:

    • Express fluorescently-tagged TMEM30A along with markers for secretory vesicles

    • Use high-resolution confocal microscopy with fast acquisition rates

    • Track co-localization through vesicular compartments

    • Measure vesicle budding rates, trafficking speeds, and fusion events

  • Insulin secretion assays in pancreatic β-cells:

    • Establish TMEM30A knockdown in β-cell lines

    • Rescue with recombinant TMEM30A expression

    • Measure glucose-stimulated insulin secretion (GSIS) using ELISA

    • Quantify insulin granule exocytosis with TIRF microscopy

    Research findings show that TMEM30A deficiency reduces insulin secretion by 65-70% compared to controls, with partial rescue by recombinant TMEM30A expression

  • Clathrin-mediated transport assessment:

    • Immunoprecipitate TMEM30A and analyze co-precipitation of clathrin and adaptor proteins

    • Visualize clathrin-coated pits and vesicles using electron microscopy

    • Measure transferrin uptake as a functional readout of clathrin-mediated endocytosis

    • Quantify budding events from the trans-Golgi network using TGN38 or other markers

  • Cargo protein trafficking:

    • Track specific TMEM30A-dependent cargo proteins (e.g., Glut2 in β-cells)

    • Perform cell surface biotinylation assays to quantify plasma membrane expression

    • Use brefeldin A as a positive control for disrupting vesicular transport

    • Correlate trafficking defects with functional outcomes

How does TMEM30A deficiency impact glycolysis pathways, and what are the methodological approaches to study this relationship?

Recent research has revealed a previously unknown connection between TMEM30A and glycolysis:

Key findings on TMEM30A and glycolysis:

  • TMEM30A knockdown significantly reduces expression of key glycolytic enzymes:

    • Hexokinase 2 (HK2): 70-75% reduction

    • Aldolase A (ALDOA): 65-70% reduction

    • Glyceraldehyde 3-phosphate dehydrogenase (GAPDH): 75-80% reduction

    • Lactate dehydrogenase A (LDHA): 60-65% reduction

Methodological approaches:

  • Transcriptomic and metabolomic analysis:

    • Perform RNA sequencing of TMEM30A knockout/knockdown cells

    • Conduct untargeted metabolomics to identify altered metabolites

    • Use pathway enrichment analysis to identify metabolic shifts

    • Results show significant enrichment in glycolysis/gluconeogenesis pathways (p < 0.01)

  • Glycolytic flux measurement:

    • Measure extracellular acidification rate (ECAR) using Seahorse XF analyzer

    • Quantify glucose uptake using fluorescent glucose analogs

    • Assess lactate production as an endpoint of glycolysis

    • Compare metabolic profiles between wild-type and TMEM30A-deficient cells

  • Enzyme activity assays:

    • Measure specific activities of glycolytic enzymes in cell lysates

    • Use 13C-labeled glucose to trace carbon flux through glycolysis

    • Analyze changes in enzyme localization that may affect pathway compartmentalization

    • Correlate enzyme activities with cellular ATP levels and redox state

  • Rescue experiments:

    • Express shRNA-resistant TMEM30A (resTmem30a) in knockdown cells

    • Measure restoration of glycolytic enzyme expression (1.7-2.5 fold increase observed)

    • Test whether glycolytic pathway modulators can rescue TMEM30A deficiency phenotypes

    • Evaluate functional outcomes in tissue-specific contexts

What are the mechanisms by which TMEM30A modulates cell cycle progression, and how can researchers effectively study these interactions?

TMEM30A's role in cell cycle control:

Mechanistic insights:

  • TMEM30A (CDC50A) was originally identified as a cell cycle control protein

  • It regulates the balance between CDK activity and phosphatase activity, particularly PP2A-B55δ

  • TMEM30A depletion accelerates entry into mitosis by affecting phosphatase activity

  • Recombinant TMEM30A addition inhibits mitotic entry in Xenopus egg extracts

Experimental approaches:

  • Cell cycle synchronization and analysis:

    • Synchronize cells at different cell cycle stages (thymidine block, nocodazole arrest)

    • Analyze TMEM30A expression and localization throughout cell cycle

    • Use flow cytometry to quantify cell cycle distribution

    • Measure CDK substrate phosphorylation as readout of cell cycle progression

  • Phosphatase activity assays:

    • Immunoprecipitate PP2A-B55δ complexes from cells with/without TMEM30A

    • Measure phosphatase activity using specific CDK substrate peptides

    • Test the effect of recombinant TMEM30A addition on phosphatase activity

    • Data shows TMEM30A depletion reduces phosphatase activity against Cdk substrates by 60-70%

  • Live-cell imaging of mitotic progression:

    • Express fluorescent cell cycle markers (PCNA, histone H2B)

    • Track individual cells through the cell cycle

    • Measure timing of key cell cycle transitions

    • Correlate with TMEM30A expression levels

  • Interaction studies:

    • Investigate physical interactions between TMEM30A and cell cycle regulators

    • Map interaction domains using deletion mutants

    • Assess effects of phosphorylation on these interactions

    • Determine if interactions are cell cycle phase-specific

What are the molecular mechanisms underlying TMEM30A's role in B-cell receptor signaling and lymphomagenesis?

Recent discoveries highlight TMEM30A's unexpected roles in B-cell function and lymphoma:

Key molecular mechanisms:

  • TMEM30A mutations in lymphoma:

    • Recurrent biallelic loss-of-function mutations observed in diffuse large B-cell lymphoma (DLBCL)

    • Mutations associated with favorable clinical outcomes

    • Mutation types include truncating (R226X, R290X, R307X) and missense (C94R, D181Y) variants

  • B-cell receptor (BCR) signaling effects:

    • TMEM30A deficiency increases BCR signaling following antigen stimulation

    • TMEM30A knockout increases BCR mobility on cell membrane

    • BCRs traverse larger areas on cell membrane (increased confinement diameter)

    • Higher percentage of BCRs in fast diffusive state observed in TMEM30A-deficient cells

  • Therapy sensitivity mechanisms:

    • TMEM30A-deficient cells show increased chemotherapy drug accumulation

    • Enhanced tumor-associated macrophage recruitment observed

    • Increased efficacy of anti-CD47 blockade in TMEM30A-deficient tumors

    • Phosphatidylserine exposure serves as "eat-me" signal for macrophages

Research methodologies:

  • BCR mobility assessment:

    • Single-particle tracking of BCR molecules

    • Use two-state hidden Markov model to analyze receptor trajectories

    • Measure diffusion coefficients and transition rates between states

    • Quantify confinement diameter of receptor movements

  • Drug accumulation studies:

    • Treat cells with fluorescent chemotherapy drugs

    • Quantify intracellular drug levels by flow cytometry or fluorescence microscopy

    • Compare accumulation kinetics between wild-type and TMEM30A-deficient cells

    • Correlate with treatment response in in vivo models

  • Immunotherapy response assessment:

    • Evaluate macrophage phagocytosis of TMEM30A-deficient cells

    • Measure response to anti-CD47 antibody treatment

    • Assess tumor infiltration by macrophages in mouse models

    • Compare survival outcomes between treatment groups

    • Results show 2.5-3 fold increase in phagocytosis in TMEM30A-deficient cells

What are common challenges in working with recombinant rat TMEM30A and how can they be addressed?

Challenge 1: Low solubility and stability

  • Problem: As a transmembrane protein, TMEM30A can aggregate and lose functional activity.

  • Solutions:

    • Use mild detergents (DDM, CHAPS) at concentrations just above CMC

    • Include glycerol (20-50%) in storage buffers

    • Maintain physiological pH (7.2-7.4) to prevent aggregation

    • Consider lipid nanodiscs for maintaining native conformation

Challenge 2: Improper glycosylation

  • Problem: Recombinant TMEM30A often shows altered glycosylation patterns affecting function.

  • Solutions:

    • Choose expression systems with appropriate glycosylation machinery (mammalian or insect cells)

    • Verify glycosylation status using PNGase F treatment and mobility shift assays

    • Consider using glycosylation site mutants to assess functional importance

    • Data shows glycosylation is critical for proper complex formation with P4-ATPases

Challenge 3: Difficulties in detecting protein-protein interactions

  • Problem: Membrane protein interactions can be disrupted during experimental procedures.

  • Solutions:

    • Use crosslinking approaches to stabilize transient interactions

    • Perform co-immunoprecipitation under native conditions

    • Consider proximity labeling techniques (BioID, APEX)

    • Utilize split-reporter assays for monitoring interactions in living cells

Challenge 4: Variable activity in functional assays

  • Problem: Inconsistent flippase activity measurements between experiments.

  • Solutions:

    • Always co-express with appropriate P4-ATPase partners

    • Standardize lipid composition in assay systems

    • Include positive controls (wild-type complexes) in each experiment

    • Develop quantitative assays with internal normalization

How can researchers resolve contradictory data regarding TMEM30A function in different experimental contexts?

Strategy 1: Consider tissue and cell-type specificity

  • TMEM30A functions differently depending on cellular context

  • Compare expression levels of P4-ATPase partners across systems

  • Assess compensatory mechanisms involving TMEM30B or TMEM30C

  • For example, TMEM30A functions differently in:

    • Pancreatic β-cells (insulin secretion)

    • Podocytes (glycolysis regulation)

    • B-cells (receptor signaling)

    • Each requiring context-specific experimental validation

Strategy 2: Validate knockout/knockdown efficiency

  • Incomplete depletion can yield contradictory results

  • Use multiple approaches to verify knockdown (qPCR, Western blot, immunostaining)

  • Consider compensatory upregulation of related proteins

  • Data shows variable phenotypes depending on knockdown efficiency (>90% needed for consistent results)

Strategy 3: Address temporal aspects of TMEM30A function

  • Some phenotypes emerge only after prolonged TMEM30A deficiency

  • Use inducible knockout/knockdown systems for temporal control

  • Track phenotypic changes over time

  • Cell cycle effects may require synchronization to observe consistently

Strategy 4: Resolve contradictions through comprehensive analysis

  • When faced with contradictory data:

    • Examine differences in experimental methodology

    • Conduct side-by-side comparisons under identical conditions

    • Use multiple complementary techniques to assess each function

    • Consider pleiotropic effects and indirect consequences of TMEM30A manipulation

What quality control measures should be applied to recombinant rat TMEM30A before experimental use?

A comprehensive quality control workflow should include:

1. Purity and integrity assessment:

  • SDS-PAGE analysis: >85% purity recommended for most applications

  • Western blot confirmation of full-length protein

  • Mass spectrometry verification of protein identity

  • Assess for degradation products that could interfere with experiments

2. Structural validation:

  • Circular dichroism to verify secondary structure elements

  • Size exclusion chromatography to assess oligomeric state

  • Thermal shift assays to evaluate protein stability

  • Proper glycosylation confirmation via mobility shift after glycosidase treatment

3. Functional activity testing:

  • Binding assays with known P4-ATPase partners

  • Phospholipid flippase activity measurement

  • ATP hydrolysis assays when co-expressed with P4-ATPases

  • Functional assays should show at least 70% of expected activity compared to positive controls

4. Application-specific validation:

  • For cell-based assays: verify cellular uptake or membrane integration

  • For rescue experiments: confirm expression levels comparable to endogenous protein

  • For structural studies: assess homogeneity and monodispersity

  • For interaction studies: validate specificity using appropriate controls

5. Batch-to-batch consistency:

  • Maintain detailed records of production and purification parameters

  • Establish reference standards for comparison

  • Document specific activity measurements for each batch

  • Consider developing a standardized activity unit definition for quantitative comparisons

What emerging technologies could advance our understanding of TMEM30A function in complex biological systems?

Emerging technology applications for TMEM30A research:

  • CRISPR-Cas9 gene editing approaches:

    • Generate tissue-specific conditional knockout models

    • Create knock-in models with fluorescent or affinity tags

    • Introduce specific disease-associated mutations

    • Enable high-throughput screening of TMEM30A interaction partners

    • Current studies with conditional knockouts have revealed tissue-specific functions

  • Cryo-EM structural studies:

    • Determine high-resolution structures of TMEM30A-P4-ATPase complexes

    • Visualize conformational changes during phospholipid transport cycle

    • Map interaction interfaces with other cellular components

    • Identify potential sites for therapeutic intervention

  • Optogenetic and chemogenetic tools:

    • Develop light or drug-inducible TMEM30A activity control

    • Enable temporal and spatial manipulation of flippase activity

    • Study acute versus chronic effects of TMEM30A modulation

    • Distinguish direct from adaptive responses to TMEM30A perturbation

  • Single-cell multi-omics approaches:

    • Correlate TMEM30A expression with transcriptomic and metabolomic profiles

    • Identify cell populations most sensitive to TMEM30A modulation

    • Map cellular trajectories following TMEM30A perturbation

    • Recent studies have identified glycolysis as a key pathway affected by TMEM30A status

How might TMEM30A research inform therapeutic approaches for conditions involving phospholipid flippase dysfunction?

Therapeutic implications of TMEM30A research:

  • Cancer treatment strategies:

    • TMEM30A mutations in DLBCL associated with favorable outcomes

    • Enhanced efficacy of anti-CD47 therapy in TMEM30A-deficient tumors

    • Potential for combinatorial approaches targeting TMEM30A and checkpoint inhibitors

    • Opportunity to develop biomarkers for treatment response prediction

    • Studies show 2.5-3 fold increase in tumor-associated macrophages in TMEM30A-deficient tumors

  • Metabolic disorder interventions:

    • TMEM30A's role in insulin secretion suggests relevance to diabetes

    • Targeting glycolysis pathway in TMEM30A-deficient conditions

    • Potential for restoring insulin secretion by modulating vesicular transport

    • TMEM30A deficiency reduces insulin secretion by 65-70% in β-cells

  • Kidney disease applications:

    • TMEM30A downregulation implicated in podocyte injury in FSGS

    • Potential therapeutic targeting of glycolysis pathway

    • Identifying patients likely to benefit from metabolic interventions

    • Research shows glycolytic enzyme reduction (60-80%) in TMEM30A-deficient podocytes

  • Neurological disorder approaches:

    • TMEM30A essential for neuronal development and function

    • Potential relevance to seizure disorders and synapse elimination

    • Therapeutic modulation of phosphatidylserine exposure on synapses

    • Studies show that TMEM30A deletion leads to preferential pruning of inhibitory synapses

What are the key unresolved questions about TMEM30A that warrant further investigation?

Critical unresolved questions:

  • Regulatory mechanisms:

    • How is TMEM30A expression and activity regulated during development and disease?

    • What post-translational modifications affect TMEM30A function?

    • How do cells compensate for TMEM30A deficiency in different contexts?

    • What signaling pathways converge on TMEM30A regulation?

  • Substrate specificity:

    • How does TMEM30A contribute to specificity of different P4-ATPase complexes?

    • Are there additional lipid substrates beyond phosphatidylserine and phosphatidylethanolamine?

    • What structural features determine substrate recognition?

    • How is substrate specificity altered in disease-associated mutations?

  • Interaction network:

    • What is the complete interactome of TMEM30A beyond P4-ATPases?

    • How does TMEM30A influence or respond to the cellular lipid environment?

    • Does TMEM30A participate in lipid rafts or other membrane microdomains?

    • What additional roles might TMEM30A play independent of P4-ATPases?

  • Mechanistic connection to glycolysis:

    • How does TMEM30A influence glycolytic enzyme expression and activity?

    • Is this effect direct or mediated through other signaling pathways?

    • Does membrane phospholipid composition affect glycolytic enzyme localization or function?

    • Can metabolic targeting compensate for TMEM30A deficiency?

  • Evolutionary conservation:

    • How are TMEM30A functions conserved across species?

    • What can comparative studies reveal about essential versus specialized functions?

    • How have TMEM30A-P4-ATPase interactions co-evolved?

    • What can we learn from organisms with simplified flippase systems?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.