Recombinant Rat Chemokine-binding protein 2 (Ccbp2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ackr2; Ccbp2; Ccr10rr; D6; Atypical chemokine receptor 2; C-C chemokine receptor D6; CCR10-related receptor; Chemokine-binding protein 2; Chemokine-binding protein D6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MPTIASPLPLATTGPENGSSIYDYDYLDDVTVLVCSKDEVLSFGRVFLPVVYSLIFVLGL AGNLLLLVVLLHSVPQRRRMIELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVV STLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKTRFRNLLLIVMVWITALAVSVPEM VFVKVHQTLDGVWHCYADFGGHATIWKLYLRFQMNLLGFLFPLLAMIFFYSRIGCVLVRL RPPGQGRALRMAAALVVVFFLLWFPYNLTLFLHSLLDLHVFGNCKISHRLDYMLQVTESL AFSHCCFTPVLYAFSSHSFRQYLKAVLSVVLRRHQAPGTAHAPPCSHSESSRVTAQEDVV SMNDLGERQADISLNKGEIGNN
Uniprot No.

Target Background

Function
Chemokine-binding protein 2 (Ccbp2) is an atypical chemokine receptor that regulates chemokine levels and localization through high-affinity chemokine binding. This binding is uncoupled from traditional ligand-driven signal transduction cascades, resulting in chemokine sequestration, degradation, or transcytosis. Ccbp2 is also known as interceptor, chemokine-scavenging receptor, or chemokine decoy receptor.

Ccbp2 serves as a receptor for various chemokines, including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES, and SCYA7/MCP-3.

Upon active ligand stimulation, Ccbp2 activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway. This pathway leads to the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling cascade. Activation of this pathway results in the up-regulation of Ccbp2 from the endosomal compartment to the cell membrane, enhancing its efficiency in chemokine uptake and degradation.

By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in the placenta, Ccbp2 plays a crucial role in resolving (terminating) the inflammatory response and regulating adaptive immune responses. It is essential for immune silencing of macrophages during inflammation resolution. Ccbp2 acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is necessary for differentiating immature/mature dendritic cells by LECs.
Database Links
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in spleen.

Q&A

What is Chemokine-binding protein 2 (Ccbp2) and what is its role in immune function?

Chemokine-binding protein 2 (Ccbp2) is a beta chemokine receptor that functions as a seven transmembrane protein similar to G protein-coupled receptors. It plays a critical role in chemokine-driven recirculation of leukocytes and the recruitment of effector immune cells to inflammation sites. The protein appears to bind the majority of beta-chemokine family members, acting as a regulator in the chemokine signaling network . In rat models, Ccbp2 is expressed in a range of tissues and hemopoietic cells, with particularly notable expression in lymphatic endothelial cells . This distribution suggests its importance in modulating immune responses through chemokine binding and potential signal transduction.

How does rat Ccbp2 differ structurally from human CCBP2?

While both rat Ccbp2 and human CCBP2 function as beta chemokine receptors, there are notable structural differences between the species. The rat variant maintains the core seven-transmembrane structure characteristic of G protein-coupled receptors but exhibits species-specific amino acid sequences that affect binding affinity and specificity. Unlike the human counterpart which is mapped to chromosome 3p21.3, rat Ccbp2 is located in a different chromosomal region but still functions within a cluster of chemokine receptor genes . The sequence homology between species reflects evolutionary conservation of function while accommodating species-specific immune responses.

What are the optimal methods for detecting Ccbp2 expression in rat tissue samples?

For detecting Ccbp2 expression in rat tissue samples, researchers should employ a multi-modal approach:

  • RT-qPCR: Design primers specific to rat Ccbp2 mRNA sequence for quantitative expression analysis

  • Western blotting: Use validated antibodies against rat Ccbp2 with appropriate positive controls

  • Immunohistochemistry/Immunofluorescence: For tissue localization studies, using paraformaldehyde-fixed tissues with validated anti-Ccbp2 antibodies

  • Flow cytometry: For detecting Ccbp2 on specific immune cell populations from dissociated tissues

When validating expression, always include appropriate controls including tissues known to express Ccbp2 (lymphatic endothelial cells) and negative controls. Expression data should be normalized to stable housekeeping genes for quantitative comparisons between experimental conditions.

How should I design an experiment to study Ccbp2 interactions with chemokines like CCL2?

When designing experiments to study Ccbp2 interactions with chemokines like CCL2, a systematic approach is essential:

Step 1: Define your variables

  • Independent variable: Concentration of recombinant CCL2 (typically ranging from 1-500 ng/mL)

  • Dependent variable: Binding affinity, receptor internalization, or downstream signaling

  • Control variables: Temperature, pH, buffer composition, cell type

Step 2: Formulate testable hypotheses
Example hypothesis: "Recombinant rat CCL2 binds to Ccbp2 with higher affinity than other beta-chemokines in a concentration-dependent manner."

Step 3: Design experimental treatments
Create a dose-response curve using multiple concentrations of recombinant rat CCL2 (Gln24-Asn148) with purified Ccbp2 or Ccbp2-expressing cells.

Step 4: Assign experimental units to groups
Use a randomized block design to control for batch effects when using cell cultures or animal models .

Step 5: Measure outcomes with appropriate techniques

  • Surface plasmon resonance for direct binding kinetics

  • FRET-based assays for protein-protein interactions

  • Flow cytometry for receptor internalization

  • Calcium flux assays for downstream signaling

CCL2 Concentration (ng/mL)Binding Response (RU)Receptor Internalization (% of baseline)Ca²⁺ Flux (fold increase)
0 (control)01001.0
1025±585±71.2±0.1
3075±865±51.8±0.2
100150±1245±62.5±0.3
300200±1535±43.1±0.2

This experimental design allows for systematic analysis of Ccbp2-chemokine interactions across multiple parameters .

What central composite design would be appropriate for optimizing Ccbp2 expression in cell culture?

A central composite design (CCD) is ideal for optimizing Ccbp2 expression in cell culture as it allows for efficient exploration of multiple factors with potential non-linear effects:

Factors to consider in the design:

  • Temperature (e.g., 32-37°C)

  • Inducer concentration (e.g., doxycycline or IPTG)

  • Duration of induction

  • Cell density at induction

  • Media composition

For a 5-factor CCD, you would need:

  • Factorial points: 2^5 = 32 (cube points)

  • Axial points: 2 × 5 = 10 (star points)

  • Center points: 6 (for estimation of experimental error)

  • Total runs: 48

Alpha (α) value calculation:
For a rotatable design with 5 factors, α = (2^5)^(1/4) = 2^(5/4) = 2.378

Example design matrix for 3 key factors:

RunTemperature (°C)Inducer (μg/mL)Duration (hours)Block
10 (34.5)0 (0.5)0 (24)1
2-1 (33)-1 (0.1)-1 (12)1
31 (36)-1 (0.1)-1 (12)1
4-1 (33)1 (0.9)-1 (12)1
51 (36)1 (0.9)-1 (12)1
...............
15-2.378 (31.1)0 (0.5)0 (24)2
162.378 (37.9)0 (0.5)0 (24)2
...............

This design allows for efficient modeling of the response surface to identify optimal conditions for Ccbp2 expression while accounting for interaction effects between factors .

How can I develop an effective binding assay to measure interactions between recombinant rat Ccbp2 and CCL2?

Developing an effective binding assay for rat Ccbp2-CCL2 interactions requires careful consideration of multiple parameters:

ELISA-based binding assay:

  • Coat high-binding microplates with recombinant rat Ccbp2 (1-5 μg/mL)

  • Block non-specific binding sites with BSA or appropriate blocking buffer

  • Add serial dilutions of biotinylated recombinant rat CCL2 (Gln24-Asn148)

  • Detect bound CCL2 with streptavidin-HRP

  • Generate saturation binding curves to determine Kd values

Cell-based binding assay:

  • Generate stable cell lines expressing rat Ccbp2

  • Use flow cytometry with fluorescently-labeled CCL2 to measure binding

  • Perform competition assays with unlabeled chemokines to determine specificity

Critical controls:

  • Include cells expressing no Ccbp2 as negative controls

  • Use known CCL2 receptor (CCR2) expressing cells as positive controls

  • Validate that the first five amino acids of mature CCL2 are intact, as deletion of the N-terminal glutamine dramatically alters binding characteristics

Data analysis approach:

  • Use non-linear regression to fit binding data to one-site or two-site binding models

  • Calculate binding parameters (Kd, Bmax) and compare across experimental conditions

  • Analyze competition data using Cheng-Prusoff equation to determine Ki values

What are the most reliable methods for studying Ccbp2 signaling pathways in primary rat immune cells?

To study Ccbp2 signaling pathways in primary rat immune cells, researchers should employ multiple complementary approaches:

1. Calcium mobilization assays:

  • Load primary cells with fluorescent calcium indicators (Fluo-4, Fura-2)

  • Measure real-time calcium flux upon stimulation with CCL2 (30-150 ng/mL)

  • Use specific inhibitors to delineate signaling pathway components

2. Phosphorylation status analysis:

  • Western blotting for phosphorylated signaling proteins (ERK1/2, p38, JNK)

  • Phospho-flow cytometry for single-cell analysis of pathway activation

  • Multiplex bead-based assays for simultaneous measurement of multiple pathways

3. Gene expression profiling:

  • RT-qPCR for immediate-early gene responses

  • RNA-seq for global transcriptional changes

  • ChIP-seq to identify transcription factor binding events

4. Functional assays:

  • Chemotaxis assays using Transwell systems

  • Adhesion assays to relevant substrates

  • Cytokine/chemokine production measurement

Data integration framework:
Create time-course experiments capturing multiple signaling events from early (seconds to minutes) to late (hours) responses. Correlate signaling pathway activation with functional outcomes to establish causality relationships.

Time pointCa²⁺ mobilizationERK phosphorylationGene expressionFunctional outcome
30 secondsPeakNot detectedNo changeNone
2 minutesDecliningIncreasingNo changeInitial adhesion
10 minutesBaselinePeakEarly genesFirm adhesion
30 minutesBaselineDecliningPeak expressionMigration initiated
2 hoursBaselineBaselineLate genesChemotaxis complete

How do I resolve inconsistent results when measuring Ccbp2-mediated chemotaxis in primary rat monocytes?

Inconsistent results in Ccbp2-mediated chemotaxis assays with primary rat monocytes can stem from multiple sources. Here's a systematic troubleshooting approach:

1. Cell preparation issues:

  • Ensure consistent monocyte isolation techniques (magnetic separation or density gradient)

  • Verify cell viability (>95%) and purity (>90%) before experiments

  • Standardize cell handling to minimize pre-activation

  • Control for donor variability by using cells from multiple animals

2. Experimental setup variables:

  • Standardize chemokine preparation and storage (avoid freeze-thaw cycles)

  • Verify the integrity of recombinant CCL2 N-terminus, as N-terminal modifications dramatically alter activity

  • Calibrate concentration ranges based on known ED50 (30-150 ng/mL for CCL2)

  • Control temperature and CO2 levels during assays

3. Data collection and analysis:

  • Use automated counting methods rather than manual counting when possible

  • Normalize migration to positive controls within each experiment

  • Apply appropriate statistical tests (repeated measures ANOVA)

  • Consider outlier analysis with pre-defined criteria

Diagnostic approach:
Create a decision tree starting with the most common issues:

  • Are positive controls (CCR2 ligands) working properly?

    • If no: Reagent or system issue

    • If yes: Continue to step 2

  • Does migration occur without specific gradient?

    • If yes: High background migration issue

    • If no: Continue to step 3

  • Is there high variability between technical replicates?

    • If yes: Pipetting or cell distribution issue

    • If no: Consider biological variability or receptor expression differences

What statistical approaches are recommended for analyzing competitive binding data between Ccbp2 and multiple chemokines?

When analyzing competitive binding data between Ccbp2 and multiple chemokines, several statistical approaches are recommended:

1. Non-linear regression analysis:

  • Fit displacement curves to determine IC50 values for each competing chemokine

  • Convert IC50 values to Ki values using the Cheng-Prusoff equation:
    Ki = IC50 / (1 + [L]/Kd)
    where [L] is the concentration of labeled ligand and Kd is its dissociation constant

2. Hierarchical clustering:

  • Group chemokines based on binding affinity profiles

  • Identify structural similarities within clusters that may predict binding properties

3. Analysis of variance (ANOVA):

  • Compare binding parameters across multiple chemokines

  • Use post-hoc tests (Tukey's, Bonferroni) for pairwise comparisons

4. Principal component analysis (PCA):

  • Reduce dimensionality of complex binding datasets

  • Identify key variables that explain most of the variance in binding profiles

Example data table for competitive binding analysis:

Competing ChemokineIC50 (nM)Ki (nM)Relative Affinity*Classification
CCL21.5±0.20.9±0.11.00High affinity
CCL74.2±0.52.5±0.30.36High affinity
CCL88.7±1.15.2±0.60.17Medium affinity
CCL1325.3±3.215.1±1.90.06Medium affinity
CCL3160±1895±110.01Low affinity
CCL4>1000>500<0.001Negligible

*Relative affinity normalized to CCL2 binding (Ki CCL2/Ki chemokine)

This statistical framework allows for rigorous comparison of binding properties across chemokine families, informing structure-function relationships in chemokine recognition by Ccbp2 .

What are the most promising approaches for studying the role of Ccbp2 in rat models of inflammation and immune disorders?

Studying the role of Ccbp2 in rat models of inflammation and immune disorders requires sophisticated approaches that combine genetic manipulation with disease modeling:

1. Genetic modulation techniques:

  • CRISPR/Cas9-mediated Ccbp2 knockout or knockin rat models

  • Conditional knockout systems (Cre-loxP) for tissue-specific deletion

  • Viral vector-mediated overexpression or knockdown in specific tissues

  • Transgenic reporter rats expressing fluorescent proteins under Ccbp2 promoter

2. Disease models relevant for Ccbp2 research:

  • Experimental autoimmune encephalomyelitis (EAE) to model multiple sclerosis

  • Collagen-induced arthritis for rheumatoid arthritis modeling

  • Ovalbumin sensitization for allergic asthma models

  • Lipopolysaccharide-induced acute inflammation

  • DSS-induced colitis for inflammatory bowel disease

3. Multi-parameter analysis methods:

  • Multi-color flow cytometry for immune cell infiltration and activation

  • Intravital microscopy for real-time leukocyte trafficking

  • Single-cell RNA sequencing for comprehensive cellular response profiling

  • Spatial transcriptomics for tissue-specific expression patterns

  • Multiplexed cytokine/chemokine profiling in tissues and biological fluids

4. Translational approaches:

  • Correlative studies between rat models and human patient samples

  • Pharmacological modulation with small molecule inhibitors or blocking antibodies

  • Ex vivo analysis of patient-derived samples in rat model systems

This multi-faceted approach allows for comprehensive understanding of Ccbp2's role in inflammation while providing translational insights for potential therapeutic interventions.

How can I design experiments to investigate the potential therapeutic applications of targeting Ccbp2 in inflammatory conditions?

Designing experiments to investigate therapeutic applications of targeting Ccbp2 requires a multiphase approach:

Phase 1: Target validation

  • Confirm Ccbp2 upregulation in relevant inflammatory tissues using immunohistochemistry and qPCR

  • Correlate expression with disease severity markers

  • Evaluate the effects of genetic deletion or overexpression on disease progression

  • Determine cell types expressing Ccbp2 in inflammatory conditions using flow cytometry and single-cell analysis

Phase 2: Intervention strategy development

  • Design blocking antibodies against rat Ccbp2

  • Develop small molecule inhibitors through rational drug design

  • Create decoy peptides based on CCL2 binding domains

  • Design antisense oligonucleotides for Ccbp2 knockdown

Phase 3: Preclinical testing

  • Establish dose-finding studies with pharmacokinetic/pharmacodynamic analyses

  • Create treatment regimens (preventive vs. therapeutic intervention)

  • Measure both clinical outcomes and molecular/cellular endpoints

  • Assess safety profile including immune function and infection susceptibility

Experimental design example:

GroupTreatmentTimingPrimary OutcomeSecondary Outcomes
1Vehicle controlDaily from day 0Disease scoreInflammatory markers, histopathology
2Anti-Ccbp2 mAb (low dose)Daily from day 0Disease scoreInflammatory markers, histopathology
3Anti-Ccbp2 mAb (high dose)Daily from day 0Disease scoreInflammatory markers, histopathology
4Anti-Ccbp2 mAb (high dose)From disease onsetDisease scoreInflammatory markers, histopathology
5Standard of carePer guidelinesDisease scoreInflammatory markers, histopathology
6Combination therapyFrom disease onsetDisease scoreInflammatory markers, histopathology

This approach provides rigorous assessment of therapeutic potential while addressing timing, dosing, and combinatorial strategies for Ccbp2-targeted interventions in inflammatory conditions.

What are the critical quality control parameters for ensuring the biological activity of recombinant rat Ccbp2 protein preparations?

Ensuring biological activity of recombinant rat Ccbp2 protein preparations requires rigorous quality control at multiple levels:

Protein purity assessment:

  • SDS-PAGE with Coomassie staining (should show ≥95% purity)

  • HPLC/FPLC chromatography profiles

  • Mass spectrometry for molecular weight confirmation and identification of potential modifications

Structural integrity verification:

  • Circular dichroism spectroscopy to assess secondary structure

  • Thermal shift assays to determine protein stability

  • Native PAGE to confirm oligomeric state

Functional activity testing:

  • Chemokine binding assays with known ligands (CCL2/MCP-1)

  • Surface plasmon resonance to determine binding kinetics

  • Cell-based reporter assays to assess receptor function

Storage stability monitoring:

  • Accelerated stability studies at different temperatures

  • Freeze-thaw cycle testing

  • Long-term activity monitoring with standardized assays

Endotoxin and contaminant testing:

  • LAL assay for endotoxin (limit <0.1 EU/μg protein)

  • Mycoplasma testing for cell-derived proteins

  • Host cell protein ELISA for expression system contaminants

Certificate of Analysis parameters:

  • Protein concentration (mg/mL)

  • Specific activity (units/mg)

  • Endotoxin level (EU/μg)

  • Purity (%)

  • Lot-to-lot consistency measures

Regular monitoring of these parameters through a comprehensive QC program ensures reliable and reproducible experimental results when working with recombinant rat Ccbp2.

How can I optimize expression systems for producing high-quality recombinant rat Ccbp2 for structural studies?

Optimizing expression systems for high-quality recombinant rat Ccbp2 production requires careful consideration of various expression platforms and purification strategies:

1. Expression system selection:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, low costLimited PTMs, inclusion bodiesTruncated domains, non-glycosylated variants
HEK293Mammalian PTMs, proper foldingModerate yield, higher costFull-length protein with native conformation
CHO cellsStable production, scalableLonger development timeLarge-scale production for structural studies
Insect cellsHigh expression, PTMsComplex setupDifficult-to-express constructs

2. Protein engineering strategies:

  • Design constructs with removable purification tags (His6, GST, MBP)

  • Engineer thermostabilizing mutations for crystallography

  • Create fusion proteins with crystallization chaperones

  • Include TEV or PreScission protease sites for tag removal

3. Expression optimization:

  • Test multiple promoters for optimal expression level

  • Optimize codon usage for expression host

  • Evaluate signal peptides for efficient secretion

  • Screen additives that enhance protein stability during expression

4. Purification strategy development:

  • Implement multi-step purification protocols:

    • Affinity chromatography (IMAC, GST)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Optimize buffer conditions to maintain native conformation

  • Include stabilizing agents (glycerol, specific ions)

  • Consider on-column refolding for difficult constructs

5. Quality assessment for structural studies:

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Differential scanning fluorimetry for thermal stability

  • Preliminary NMR for structural integrity

  • Dynamic light scattering for monodispersity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.