Recombinant Rat Chloride channel CLIC-like protein 1 (Clcc1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Chloride Channel CLIC-Like Protein 1 (Clcc1)

Recombinant Rat Chloride channel CLIC-like protein 1 (Clcc1) is a protein coded by the Clcc1 gene in Rattus norvegicus (Rat) . Clcc1 is also known as Mid-1-related chloride channel protein 1 and Mclc . The protein sequence consists of 541 amino acids .

Gene and Protein Information

FeatureDescription
Gene NameClcc1
SynonymsMclc
Protein NamesChloride channel CLIC-like protein 1, Mid-1-related chloride channel protein 1
SpeciesRattus norvegicus (Rat)
UniProt No.Q9WU61
Expression Region19-541
Sequence InfoFull length protein; HDDDWIDPTDMLNYDAASGTMRKSQAKYGTSEKKEVNPGLSDAQELSDCLQRLDSLTHKVDDCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGLPDEDRVDVRYDAEILLTRQTLLEIQKFLSGEEWKPGALDDALSDILTNFKSHDAEAWKWQFEDYFGVDPYNVFMVLLCLLCIVALVATELWTYVRWHTQLKRVCIISFLVSLGWNWIYLYKVAFAQHQANVAKMAPLNDVCAKKMDWTENLWEWFRISWTYKDDPCQKYYELLIVNPIWLVPPTKALAVTFTNFVTEPLKYIGKGTGEFIKALMKEIPVLLQIPVLVILALAVLGFCYGAGQSVPMLRHFRGPEREPPRALEPDDRRRQKELDYRFHGGAGDADFSYRGPAGSIEQGPYDKMHVCERDVLRQRQVNMRFPSGNKSPEVLRAFDLPDTEAQEHPEVVPSHKPSIVNTSLKETSELPRESTLAECSQCAKDGSGQVPSTAESSPIVEKAQLKTDSECRPHSTEAAAAAARGTDPVSSPCG

Function and Localization

CLCC1 is a presumptive intracellular chloride channel highly expressed in the retina . It is localized to the endoplasmic reticulum (ER), Golgi, and nucleus and contains three putative transmembrane domains and a signal peptide at the N-terminus . CLCC1 interacts with Calreticulin, a major calcium-binding protein in the ER lumen, which is likely active in calcium storage and possibly transcriptional regulation .

Role in Disease

Mutations in CLCC1 are associated with diseases such as retinitis pigmentosa and amyotrophic lateral sclerosis (ALS) . Specifically, disruption of ER ion homeostasis maintained by CLCC1 contributes to ALS-like pathologies . Intracellular chloride transport by CLCC1 is critical for maintaining retinal integrity, and CLCC1 is crucial for the survival and function of retinal cells .

Research Findings

  • Mutation Effects: A homozygous missense alteration (c.75C>A, p.D25E) in CLCC1 decreases channel activity . The p.D25E mutation does not significantly alter the interaction of CLCC1 with Calreticulin or its localization within the ER, Golgi, lysosomes, or nucleus .

  • Channel Activity: Microsomes from mutant cells presented a small current conductance with clear open/close channel activities, while those from wild-type (WT) cells showed a large open conductance with rare fluctuation activity .

  • Apoptosis: Small interfering RNA (siRNA) knockdown of CLCC1 induces apoptosis in cultured retinal pigment epithelium cells .

  • ALS Association: Rare damaging variants in CLCC1 have been identified in patients with ALS, suggesting a potential role in the disease . Patients harboring CLCC1 variants may share clinical features, including earlier age at onset, rapid progression, spinal onset, and vulnerable cognitive status .

  • ER Anion Channel: CLCC1 functions as a pore-forming component of an ER anion channel, and ALS-associated mutations impair channel conductance . Conditional knockout of Clcc1 causes motor neuron loss, ER stress, misfolded protein accumulation, and ALS pathologies in the spinal cord .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Clcc1; Mclc; Chloride channel CLIC-like protein 1; Mid-1-related chloride channel protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-541
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
HDDDWIDPTDMLNYDAASGTMRKSQAKYGTSEKKEVNPGLSDAQELSDCLQRLDSLTHKV DDCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGLPDEDRVDVRYDAEILLTRQTLLEIQ KFLSGEEWKPGALDDALSDILTNFKSHDAEAWKWQFEDYFGVDPYNVFMVLLCLLCIVAL VATELWTYVRWHTQLKRVCIISFLVSLGWNWIYLYKVAFAQHQANVAKMAPLNDVCAKKM DWTENLWEWFRISWTYKDDPCQKYYELLIVNPIWLVPPTKALAVTFTNFVTEPLKYIGKG TGEFIKALMKEIPVLLQIPVLVILALAVLGFCYGAGQSVPMLRHFRGPEREPPRALEPDD RRRQKELDYRFHGGAGDADFSYRGPAGSIEQGPYDKMHVCERDVLRQRQVNMRFPSGNKS PEVLRAFDLPDTEAQEHPEVVPSHKPSIVNTSLKETSELPRESTLAECSQCAKDGSGQVP STAESSPIVEKAQLKTDSECRPHSTEAAAAAARGTDPVSSPCG
Uniprot No.

Target Background

Function
Functions as a chloride ion channel and plays a role in retinal development.
Database Links
Protein Families
Chloride channel MCLC family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in testis (spermatocytes), liver and lung (at protein level). Expressed in spleen, liver, testis, kidney, heart, brain and lung.

Q&A

What is the structural relationship between Clcc1 and other CLIC family proteins?

Chloride channel CLIC-like protein 1 (Clcc1) belongs to the broader CLIC protein family, which uniquely transition between soluble and membrane-associated conformations. Like other CLIC proteins, Clcc1 shares structural similarities with the glutathione S-transferase (GST) fold family. The typical CLIC protein structure consists of an N-terminal thioredoxin domain (TRX) followed by a C-terminal α domain, forming a globular conformation in its soluble state . When investigating Clcc1, researchers should consider these structural features when designing experiments, particularly those focused on membrane interactions and conformational changes.

How should Recombinant Rat Clcc1 be stored and handled to maintain optimal activity?

Based on stability data for related CLIC proteins, recombinant Clcc1 should be stored as a lyophilized powder at -20 to -80°C, where it can remain stable for up to 12 months . After reconstitution, the protein solution can typically be stored at 4-8°C for short periods (2-7 days), while aliquots of reconstituted samples should be stored at < -20°C for longer-term use (up to 3 months) . It is crucial to minimize freeze-thaw cycles as these can compromise protein integrity and activity. When preparing experiments, researchers should reconstitute the protein in an appropriate buffer system, typically containing physiological salt concentrations (e.g., 150mM NaCl) and a suitable pH buffer (e.g., 20mM Tris, pH 8.0) .

What expression systems are most effective for producing Recombinant Rat Clcc1?

While E. coli-based expression systems are commonly used for producing recombinant CLIC proteins due to their cost-effectiveness and high yield , researchers should consider that Clcc1 may require post-translational modifications that bacterial systems cannot provide. For studies focused on Clcc1's native conformation and activity, mammalian or insect cell expression systems might yield protein with more physiologically relevant modifications. When using E. coli systems, codon optimization for rat protein expression and inclusion of fusion tags (such as 6His) for purification are standard approaches . Purification typically involves affinity chromatography, followed by size exclusion chromatography to ensure monodispersity of the protein sample.

How can researchers effectively study the pH-dependent membrane association of Clcc1?

CLIC proteins demonstrate pH-dependent membrane association, with acidic pH facilitating transition to membrane-associated conformations . To study this property in Clcc1, researchers should design liposome-based assays where protein-membrane interactions can be measured under controlled pH conditions.

Methodologically, researchers can:

  • Prepare liposomes of defined composition (consider including negatively charged phospholipids)

  • Label liposomes with fluorescent dyes (e.g., dansyl-PE) for FRET-based interaction assays

  • Incubate Clcc1 with liposomes at various pH values (typically ranging from pH 5.0 to 7.5)

  • Measure membrane association through:

    • Liposome co-flotation assays

    • FRET between Clcc1 tryptophan residues and dansyl-PE-labeled liposomes

    • Direct visualization using electron microscopy

For quantitative analysis, researchers should establish pH titration curves by plotting the percentage of membrane-associated Clcc1 versus pH, which can reveal the pH threshold for conformational transition .

What experimental approaches are most reliable for investigating potential fusogenic activity of Clcc1?

Recent research has revealed that some CLIC proteins, particularly CLIC5, function as fusogens . To investigate whether Clcc1 shares this property, researchers should implement lipid mixing and content mixing assays with liposomes.

For lipid mixing assays:

  • Prepare R18-labeled liposomes (R18 at self-quenching concentrations)

  • Mix with unlabeled liposomes (typically at a 1:4 ratio)

  • Add purified Clcc1 at various concentrations

  • Monitor R18 fluorescence over time, where increased signal indicates membrane fusion

For content mixing assays:

  • Prepare two populations of liposomes containing either ANTS (fluorophore) or DPX (quencher)

  • Mix the liposome populations

  • Add Clcc1 at varying concentrations

  • Monitor ANTS fluorescence, where decreased signal indicates content mixing

Critical controls should include:

  • Protein-free buffer (negative control)

  • Known fusogens like DOC2B (positive control)

  • Heat-denatured Clcc1 (structural specificity control)

  • Mutated Clcc1 with altered inter-domain interface (mechanism control)

How should researchers address the apparent contradiction between Clcc1's predicted function as a chloride channel and emerging evidence for alternative functions?

Despite their nomenclature as chloride channels, the ion channel function of CLIC proteins remains debated . When studying Clcc1, researchers should design experiments that can differentiate between channel activity and alternative functions such as fusogenic activity or roles in membrane remodeling.

To address this contradiction:

  • Design parallel experimental approaches:

    • Electrophysiological assays to test ion conductance (patch clamp or planar lipid bilayer recordings)

    • Membrane fusion assays (as described above)

    • Membrane remodeling assays (using giant unilamellar vesicles and confocal microscopy)

  • Create control constructs:

    • Site-directed mutants targeting putative channel-forming regions

    • Mutants altering the inter-domain interface important for fusogenic activity

  • Compare activity under various conditions:

    • Varying pH (5.0-7.5)

    • Oxidizing vs. reducing environments

    • Different lipid compositions

  • Employ cellular models with Clcc1 knockout/knockdown to identify phenotypes consistent with either channel or non-channel functions

This multi-faceted approach can help resolve the functional duality of Clcc1 and contribute to our understanding of the physiological roles of CLIC proteins in general .

What are the critical factors for designing in vitro assays to study Clcc1 membrane interactions?

When designing in vitro assays for studying Clcc1 membrane interactions, researchers must carefully control several experimental parameters:

ParameterRange to TestRationale
pH5.0-7.5CLIC proteins show pH-dependent membrane association
Redox conditionsOxidizing vs. reducingMembrane insertion is redox-regulated
Lipid compositionVary PE, PS, PI, cholesterol contentMembrane composition affects CLIC insertion
Protein concentration0.1-10 μMDose-dependent effects on membrane interaction
Temperature25°C and 37°CPhysiological vs. standard assay conditions
Ionic strength50-300 mM NaClAffects electrostatic interactions

Additionally, researchers should verify protein quality before each experiment through:

  • Size exclusion chromatography to confirm monomeric state

  • Circular dichroism to verify proper folding

  • Activity assays with positive controls to ensure functional integrity

These controls are essential as CLIC proteins can undergo conformational changes that affect their activity during storage or under different experimental conditions .

What cellular models are most appropriate for studying Clcc1 physiological functions?

Based on research with other CLIC proteins, several cellular models may be appropriate for studying Clcc1:

  • Macrophage models: CLIC1 has been shown to translocate to phagosomal membranes during phagocytosis and regulate phagosome acidification . If Clcc1 shares similar functions, macrophage cell lines or primary macrophages would be valuable models.

  • Kidney cell models: CLIC proteins contribute to normal kidney function , making kidney epithelial cell lines potential models for Clcc1 studies.

  • Endothelial cell models: Given the role of some CLIC proteins in angiogenesis , endothelial cells could be appropriate for investigating Clcc1's potential involvement in vascular functions.

When using these models, researchers should:

  • Establish Clcc1 knockout/knockdown systems

  • Develop systems for controlled expression of fluorescently tagged Clcc1

  • Include rescue experiments with wild-type and mutant Clcc1 constructs

  • Monitor subcellular localization under resting conditions and various stimuli

  • Assess phenotypes related to membrane dynamics, vesicle fusion, and organelle function

How can researchers effectively characterize the tissue-specific expression patterns of Clcc1?

Understanding the tissue-specific expression patterns of Clcc1 is crucial for interpreting its physiological roles. Researchers should employ multiple complementary approaches:

  • Transcriptomic analysis:

    • RNA-seq of various rat tissues

    • Single-cell RNA-seq for cellular resolution

    • Comparison with public databases (e.g., Rat Genome Database)

  • Protein-level analysis:

    • Western blotting of tissue lysates

    • Immunohistochemistry for spatial distribution

    • Mass spectrometry-based proteomics

  • Reporter systems:

    • Generation of Clcc1 promoter-driven reporter constructs

    • Creation of knock-in fluorescent reporter rat models

Based on related CLIC proteins, researchers might expect expression in heart, placenta, liver, kidney, and pancreas tissues , but Clcc1-specific patterns may differ and should be empirically determined.

How can researchers investigate the potential role of Clcc1 in phagosome maturation and acidification?

Building on findings that CLIC1 contributes to phagosome acidification in macrophages , researchers can investigate Clcc1's potential role through:

  • Live cell imaging using pH-sensitive fluorophores:

    • Label target particles (e.g., zymosan) with pH-sensitive dyes like Oregon Green 488

    • Synchronize phagocytosis and monitor pH changes over time

    • Compare wild-type vs. Clcc1-deficient macrophages

  • Phagosome isolation and biochemical characterization:

    • Isolate phagosomes at different maturation stages

    • Analyze protein composition by western blot and mass spectrometry

    • Determine if Clcc1 is recruited to phagosomes and at what stage

  • Functional assays:

    • Measure proteolytic activity using fluorogenic substrates

    • Assess reactive oxygen species (ROS) production in phagosomes

    • Evaluate phagosomal-lysosomal fusion using fluorescent markers

  • Molecular intervention:

    • Complement Clcc1-deficient cells with wild-type or mutant Clcc1

    • Test pH-insensitive or redox-insensitive Clcc1 mutants

    • Use specific inhibitors of known phagosome acidification pathways

These approaches can help determine whether Clcc1 contributes to phagosome function similarly to CLIC1 or has distinct roles .

What structural biology techniques are most informative for determining Clcc1 conformational changes?

Understanding the structural transitions of Clcc1 between soluble and membrane-associated forms requires a multi-technique approach:

  • X-ray crystallography:

    • Determine high-resolution structures of soluble Clcc1

    • Co-crystallize with potential binding partners

    • Generate crystals of stabilized membrane-associated conformations

  • Cryo-electron microscopy:

    • Visualize Clcc1 in membrane environments

    • Capture transitional states during membrane insertion

    • Determine oligomeric structures in membranes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map solvent-accessible regions in different conditions

    • Identify regions undergoing conformational changes during pH shifts

    • Detect protein-protein and protein-lipid interaction interfaces

  • FRET-based sensors:

    • Design intramolecular FRET pairs to monitor domain movements

    • Measure real-time conformational changes during membrane association

    • Determine kinetics of structural transitions

  • Molecular dynamics simulations:

    • Model transitions between soluble and membrane forms

    • Predict effects of mutations on structural stability

    • Simulate interactions with lipid bilayers

By combining these approaches, researchers can develop a comprehensive understanding of Clcc1's structural plasticity and the molecular mechanisms underlying its functions .

How should researchers interpret contradictory findings between in vitro and cellular studies of Clcc1?

When facing contradictions between in vitro and cellular studies of Clcc1, researchers should:

  • Consider contextual factors:

    • Cellular environment provides binding partners absent in vitro

    • Membrane composition differs between artificial systems and cells

    • Post-translational modifications may be lacking in recombinant proteins

  • Perform bridging experiments:

    • Use semi-purified cellular fractions

    • Reconstitute Clcc1 with potential binding partners

    • Add cellular extracts to in vitro systems

  • Develop quantitative frameworks:

    • Create mathematical models that incorporate multiple variables

    • Define parameter spaces where contradictions can be reconciled

    • Use systems biology approaches to integrate diverse datasets

  • Employ genetic models with graduated phenotypes:

    • Generate partial loss-of-function mutations

    • Create tissue-specific or inducible knockout models

    • Develop knock-in models with altered regulatory elements

Through systematic examination of discrepancies, researchers can develop more nuanced understandings of Clcc1 function that account for its context-dependent behavior .

What are the most promising directions for investigating Clcc1's role in disease models?

Based on the physiological roles of related CLIC proteins, several disease-relevant directions merit investigation for Clcc1:

  • Inflammatory conditions:

    • CLIC1-deficient mice show protection from arthritis development

    • Investigate Clcc1 in inflammatory disease models

    • Explore macrophage-mediated inflammation

  • Kidney disorders:

    • CLICs contribute to normal kidney function

    • Study Clcc1 in models of kidney injury or dysfunction

    • Investigate role in renal epithelial cell function

  • Vascular pathologies:

    • Some CLICs are involved in angiogenesis

    • Examine Clcc1 in models of abnormal vascular development

    • Study potential roles in tumor angiogenesis

  • Cell cycle regulation disorders:

    • CLIC1 is involved in cell cycle regulation

    • Investigate Clcc1 in cancer models

    • Study proliferation phenotypes in Clcc1-deficient cells

These research directions should employ both loss-of-function and gain-of-function approaches, alongside careful phenotypic characterization at molecular, cellular, and physiological levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.