Recombinant Rat Chloride intracellular channel protein 2 (Clic2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Clic2; Chloride intracellular channel protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Clic2
Target Protein Sequence
MASLALNTQADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTARKPEE LKDLAPGTNPPFLIYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKF SAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLT LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHTCPEDKEIENTYA SVAKQ
Uniprot No.

Target Background

Function

Recombinant Rat Chloride intracellular channel protein 2 (Clic2) inserts into membranes to form chloride ion channels. Channel activity is pH-dependent. Membrane insertion appears to be redox-regulated and may only occur under oxidizing conditions. Clic2 modulates RYR2 activity and inhibits calcium influx.

Database Links
Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is CLIC2 and how does it differ from other CLICs?

CLIC2 belongs to the family of chloride intracellular channel proteins, which are relatively small globular proteins with a molecular mass of approximately 30 kDa. While CLIC2 shares structural similarities with other CLICs, it has distinctive characteristics that set it apart. Unlike other CLICs, CLIC2 contains an intramolecular disulfide bridge that maintains it in a monomeric state, while other CLICs like CLIC1 can form dimers. CLIC2 also features a highly charged region called the "foot loop" on its C-terminal side, which may mediate interactions with other molecules . The CLIC2 gene is notably absent in mice, which has impeded research through knockout experiments, making rat and human models particularly valuable for CLIC2 studies .

How is CLIC2 expression regulated in normal versus pathological tissues?

CLIC2 demonstrates differential expression patterns between normal and pathological tissues. In human studies, CLIC2 expression is significantly higher in normal tissues compared to cancer tissues. This pattern has been observed in hepatocellular carcinoma, colorectal cancer, and metastatic liver cancers . At the cellular level, CLIC2 is predominantly expressed in blood vessel endothelial cells of normal tissues, CD11b-expressing myeloid leukocytes, and fibroblast-like cells in cancer stroma .

Benign tumors express CLIC2 at much higher levels than malignant ones. For instance, grade I meningiomas (benign brain tumors) express significantly higher levels of CLIC2 protein and mRNA compared to grade IV glioblastomas (highly malignant invasive brain tumors) . This pattern suggests CLIC2 may function as a tumor suppressor, potentially by preventing cellular invasion into surrounding tissues. The mechanisms regulating this differential expression remain incompletely understood and represent an important area for future research .

What are the optimal methods for producing recombinant rat CLIC2?

For producing recombinant rat CLIC2, researchers have successfully employed cell-free wheat germ protein synthesis systems, which yield functional protein capable of inhibiting MMP14 activity . This approach offers advantages for producing proteins that might affect cellular processes when expressed in bacterial or mammalian expression systems.

When designing expression constructs, consideration should be given to the inclusion of purification tags (His-tag or GST-tag) that can be later cleaved with specific proteases to obtain native protein. For purification, given CLIC2's high solubility in aqueous buffers, standard chromatographic techniques are effective, including:

  • Affinity chromatography (using tagged constructs)

  • Ion exchange chromatography (utilizing CLIC2's charged regions)

  • Size exclusion chromatography (for final polishing)

During purification, maintaining reducing conditions is crucial to preserve CLIC2's native conformation and prevent non-specific disulfide formation, while avoiding extremely acidic environments (pH < 5.0) that might trigger premature membrane-inserting conformational changes .

How can researchers effectively study CLIC2-MMP14 interactions?

To investigate CLIC2-MMP14 interactions, researchers should consider multiple complementary approaches:

Binding Assays:

  • Co-immunoprecipitation can detect the physical association between CLIC2 and MMP14, though this interaction appears relatively weak

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) can quantify binding kinetics

  • Fluorescence resonance energy transfer (FRET) with labeled proteins can visualize interactions in real-time

Functional Assays:

  • MMP14 enzymatic activity can be measured using fluorogenic peptide substrates in the presence of varying concentrations of recombinant CLIC2

  • Comparative analysis with known MMP inhibitors such as N-Isobutyl-N-[4-methoxyphenylsulfonyl] glycyl hydroxamic acid or TIMP2 can benchmark CLIC2's inhibitory potency

InhibitorRelative MMP14 Inhibitory PotencyConcentration Range for Effect
Recombinant CLIC2HighConcentration-dependent inhibition
TIMP2Moderate (less than CLIC2)Similar concentration range as CLIC2
N-Isobutyl-N-[4-methoxyphenylsulfonyl] glycyl hydroxamic acidHigh (comparable to CLIC2)Similar concentration range as CLIC2

For cellular studies, researchers should examine CLIC2's effect on MMP14 plasma membrane localization, as evidence suggests CLIC2 may inhibit proper MMP14 trafficking to the cell surface .

What considerations are necessary when designing experiments with rat CLIC2 models?

When designing experiments with rat CLIC2 models, researchers should consider several key factors:

  • Species-specific differences: While detailed information on rat-specific CLIC2 is limited in the provided search results, researchers should acknowledge potential functional differences between rat and human CLIC2

  • Expression system selection: For in vitro studies, the choice between bacterial, insect, mammalian, or cell-free expression systems should consider the need for post-translational modifications and proper protein folding

  • Physiological relevance: Given that CLIC2 functions may be context-dependent, experiments should be designed to recreate physiologically relevant conditions, particularly regarding pH, redox environment, and cellular localization

  • Validation strategies: Multiple approaches should be employed to validate findings, including:

    • siRNA/shRNA knockdown experiments

    • Recombinant protein rescue experiments

    • Domain-specific mutations to identify functional regions

    • Complementary in vitro and in vivo approaches

  • Readout selection: Appropriate assays should be selected based on the CLIC2 function being investigated:

    • Ion channel activity: patch-clamp electrophysiology

    • MMP inhibition: zymography, fluorogenic substrate assays

    • Cell adhesion effects: transendothelial electrical resistance, permeability assays

    • Tumor invasion: matrix degradation assays, invasion chambers

How does recombinant CLIC2 modulate MMP activity in experimental models?

Recombinant CLIC2 has demonstrated significant inhibitory effects on matrix metalloproteinase activity in experimental models. When recombinant CLIC2 protein was prepared using a cell-free wheat germ protein synthesis system and added to MMP14 activity assays, it inhibited MMP14 activity in a concentration-dependent manner . This inhibitory effect was comparable to that of N-Isobutyl-N-[4-methoxyphenylsulfonyl] glycyl hydroxamic acid, a broad-spectrum water-soluble MMP inhibitor, at equivalent concentrations .

Notably, CLIC2's inhibitory effect on MMP14 activity was stronger than that of tissue inhibitor of metalloproteinase 2 (TIMP2), an endogenous inhibitory protein for MMPs . The mechanism appears to involve direct binding of CLIC2 to MMP14, as demonstrated by immunoprecipitation studies, albeit with relatively weak binding affinity . The inhibition mechanism may be similar to that of TIMP2, as no synergistic effect was observed when both inhibitors were combined in MMP14 activity assays .

This MMP14 inhibition by CLIC2 consequently leads to reduced MMP2 activation, as MMP14 typically activates MMP2 by partially degrading proMMP2. In cell culture models, higher CLIC2 expression correlates with lower levels of activated MMP2 . This cascade of inhibitory effects on MMPs may explain CLIC2's role in preventing cancer cell invasion and metastasis.

What is the relationship between CLIC2 expression and cancer progression?

CLIC2 expression demonstrates a significant inverse relationship with cancer progression across multiple tumor types. Higher CLIC2 expression is consistently associated with less aggressive disease and better clinical outcomes:

  • Expression patterns: CLIC2 is expressed at higher levels in benign tumors compared to malignant ones. For example, grade I meningiomas (benign) express significantly more CLIC2 than grade IV glioblastomas (highly malignant) .

  • Cancer invasion: CLIC2 appears to prevent tumor cell invasion into surrounding tissues. Cancer tissues consistently show lower CLIC2 expression than surrounding normal tissues across multiple cancer types, including hepatocellular carcinoma and colorectal cancer .

  • Disease progression: In hepatocellular carcinoma, CLIC2 expression decreases in advanced stages and in cases complicated by liver fibrosis .

  • Survival data: Clinical data demonstrate that progression-free survival (PFS) is significantly prolonged in both meningioma and glioblastoma cases when CLIC2 is highly expressed . Similar associations between high CLIC2 expression and prolonged survival have been observed in gastric and lung cancer databases .

The mechanisms underlying these relationships appear multifaceted:

  • CLIC2 inhibits MMP14 activity, reducing extracellular matrix degradation necessary for invasion

  • CLIC2 contributes to the maintenance of tight junctions between endothelial cells, potentially limiting vascular permeability and hematogenous metastasis

  • CLIC2 expression may influence cell adhesion molecule expression, such as E-cadherin in tumor cells

These findings collectively suggest CLIC2 functions as a tumor suppressor, with its loss contributing to more aggressive disease phenotypes.

How does CLIC2 influence vascular permeability and endothelial tight junctions?

CLIC2 plays a crucial role in regulating vascular permeability through its effects on endothelial tight junctions. CLIC2-expressing blood vessel endothelial cells in normal tissues also express tight junction proteins including claudins 1 and 5, occludin, and ZO-1 (TJP1) . In contrast, blood vessel endothelial cells in cancer tissues and lymphatic endothelial cells that lack CLIC2 expression do not express these tight junction proteins .

In experimental models using Evans blue dye injections to assess vascular permeability, tumors with high CLIC2 expression showed reduced permeability compared to those with low CLIC2 expression . This suggests that CLIC2 strengthens the barrier function of blood vessels, potentially through:

  • Direct maintenance of tight junction integrity between endothelial cells

  • Regulation of adhesion molecule expression, such as E-cadherin and VE-cadherin

  • Inhibition of MMP activity that would otherwise degrade junction proteins

The relationship between CLIC2 and vascular permeability has significant implications for cancer metastasis, as increased vascular permeability is associated with hematogenous metastasis . By maintaining tight junctions between vascular endothelial cells, CLIC2 may create a physical barrier that prevents cancer cells from entering the bloodstream, thus suppressing distant metastasis.

This function may be particularly significant given that CLIC2 is secreted extracellularly in significant amounts , allowing it to act on the external surface of endothelial cells and potentially modulate cell-cell junctions through mechanisms distinct from traditional ion channel functions.

What are common challenges in working with recombinant CLIC2 and how can they be addressed?

Researchers working with recombinant CLIC2 face several technical challenges that require specific troubleshooting approaches:

Challenge 1: Conformational Heterogeneity
CLIC2 exists in both soluble and membrane-integrated forms, with transitions influenced by pH and redox conditions . This dimorphic nature can complicate experimental interpretation.

Solutions:

  • Carefully control buffer pH and redox conditions during purification and storage

  • Characterize protein conformation using circular dichroism or intrinsic fluorescence before experiments

  • Consider using site-directed mutagenesis to stabilize specific conformations

  • Perform parallel experiments under different conditions to distinguish conformation-specific effects

Challenge 2: Low Ion Channel Activity
Despite being classified as a chloride channel, CLIC2 shows poor ion selectivity and requires non-physiological conditions (pH 5.0) for optimal channel activity .

Solutions:

  • Use multiple electrophysiological techniques (patch-clamp, planar lipid bilayers)

  • Include positive controls with known chloride channels

  • Consider alternative functions beyond ion conductance as primary research focus

  • Employ fluorescence-based ion flux assays as complementary approaches

Challenge 3: Species Differences
The absence of CLIC2 in mice and limited information about rat CLIC2 creates challenges for translational research .

Solutions:

  • Perform detailed sequence and structural comparisons between human and rat CLIC2

  • Validate findings across species whenever possible

  • Consider using humanized rat models for specific CLIC2 studies

  • Clearly acknowledge species-specific limitations in research reports

Challenge 4: Weak Protein-Protein Interactions
CLIC2 interactions with partners like MMP14 appear relatively weak , making them difficult to detect and characterize.

Solutions:

  • Use chemical crosslinking to stabilize transient interactions

  • Employ highly sensitive detection methods (SPR, MST, BLI)

  • Increase protein concentration while monitoring aggregation

  • Consider fusion constructs to enhance interaction stability for initial characterization

How can researchers reconcile contradictory data on CLIC2 functions?

Reconciling contradictory data on CLIC2 functions requires systematic approaches to address the protein's multifunctional nature:

  • Contextual Analysis: CLIC2 functions appear highly context-dependent. Researchers should carefully document and compare:

    • Cell/tissue type

    • Subcellular localization

    • Experimental conditions (pH, redox state)

    • Protein concentration

    • Presence of binding partners

  • Functional Domain Mapping: The multifunctional nature of CLIC2 suggests different domains may mediate different functions:

    • The highly charged "foot loop" region may mediate MMP14 binding

    • Different regions may be responsible for RyR binding versus MMP inhibition

    • Systematic domain deletion/mutation studies can help assign functions to specific regions

  • Reconciliation Framework: When facing contradictory data, consider:

FunctionSupporting EvidenceContradictory EvidenceReconciliation Approach
Ion ChannelForms channels in lipid bilayers Poor selectivity, requires non-physiological pH May be secondary function or require specific activators in vivo
MMP14 InhibitorDirect binding and inhibition demonstrated Weak binding affinity May require cofactors or specific conditions for optimal inhibition
Adhesion Junction RegulatorCorrelation with tight junction proteins Mechanism unclearMay act indirectly through MMP inhibition rather than direct junction regulation
  • Methodological Considerations: Different methods can yield contradictory results:

    • In vitro versus in vivo studies

    • Overexpression versus knockdown approaches

    • Recombinant protein versus endogenous protein studies

    • Acute versus chronic manipulations

Systematically comparing methodological differences can often explain apparent contradictions and reveal context-dependent functions.

What are the best methods to validate recombinant CLIC2 activity?

Validating recombinant CLIC2 activity requires a multi-faceted approach targeting its diverse functions:

Structural Validation:

  • Circular dichroism to confirm secondary structure

  • Dynamic light scattering to assess homogeneity and aggregation state

  • Limited proteolysis to verify proper folding

  • Thermal shift assays to assess stability

Functional Validation:

  • Ion Channel Activity:

    • Planar lipid bilayer electrophysiology to measure conductance

    • pH-dependent activity profile (optimal at pH 5.0)

    • Ion selectivity assays to verify chloride conductance

  • MMP14 Inhibition:

    • Fluorogenic substrate assays with purified MMP14

    • Concentration-dependent inhibition curves

    • Comparison with established inhibitors (TIMP2, synthetic inhibitors)

    • Zymography to assess effects on MMP2 activation

  • RyR Regulation:

    • Ca²⁺ flux assays in RyR-expressing systems

    • Binding assays to verify direct interaction

    • Electrophysiological recording of RyR channel activity

  • Cellular Effects:

    • Transendothelial electrical resistance measurements

    • Tight junction formation assessment

    • Cell invasion assays

    • Vascular permeability assays

Comparative Validation:

Functional PropertyPositive ControlNegative ControlExpected Result for Active CLIC2
MMP14 InhibitionTIMP2, synthetic inhibitors Heat-denatured CLIC2Concentration-dependent inhibition exceeding TIMP2 potency
RyR RegulationKnown RyR modulatorsCLIC2 H101Q mutant (activates rather than inhibits) Inhibition of Ca²⁺ release
Tight Junction EffectTight junction-promoting factorsCLIC2-depleted conditioned mediaEnhanced barrier function

For comprehensive validation, researchers should verify at least two independent functions of CLIC2, as confirmation of multiple activities provides stronger evidence of proper folding and biological relevance.

What are the unexplored aspects of rat CLIC2 that warrant further investigation?

Several unexplored aspects of rat CLIC2 represent promising avenues for future research:

  • Comparative Species Analysis: While the CLIC2 gene is absent in mice , its presence and function in rats remain undercharacterized. A systematic comparison between rat and human CLIC2 could reveal species-specific functions and provide insights into evolutionary conservation of this protein's roles.

  • Post-translational Modifications: The regulatory mechanisms controlling CLIC2 activity, including potential phosphorylation, glycosylation, or other modifications, remain largely unknown. Proteomic analysis of native rat CLIC2 could identify modification patterns that influence function.

  • Secretion Mechanisms: CLIC2 is secreted extracellularly in significant amounts , but the secretory pathway and regulatory mechanisms remain undefined. Investigating whether rat CLIC2 uses conventional or unconventional secretion pathways could provide insights into its extracellular functions.

  • Tissue-Specific Functions: CLIC2 is widely expressed in various organs and cells , but tissue-specific functions beyond vascular endothelium remain largely unexplored. Systematic characterization of rat CLIC2 expression and function across different tissues could reveal specialized roles.

  • Interaction Network: Beyond MMP14 and RyRs, the complete interactome of CLIC2 remains unknown. Unbiased proteomic approaches to identify binding partners in rat tissues could reveal novel functions and regulatory mechanisms.

  • Redox-Dependent Functions: Given the presence of an intramolecular disulfide bridge in CLIC2 , its potential role in redox sensing or regulation warrants investigation, particularly in oxidative stress conditions relevant to cancer and cardiovascular disease.

How can recombinant CLIC2 be leveraged for therapeutic applications?

Recombinant CLIC2 shows potential for therapeutic applications based on its biological activities:

  • Cancer Metastasis Inhibition: Given CLIC2's ability to inhibit MMP14 activity and its inverse correlation with cancer progression , recombinant CLIC2 could be developed as an anti-metastatic agent. Development strategies might include:

    • PEGylated CLIC2 for extended half-life

    • Tumor-targeted delivery systems

    • Combination with existing anti-cancer therapies

    • Identification of the minimal CLIC2 domain required for MMP inhibition

  • Vascular Barrier Enhancement: CLIC2's role in maintaining endothelial tight junctions suggests applications for conditions with vascular leakage, such as:

    • Inflammatory disorders

    • Diabetic vasculopathy

    • Blood-brain barrier dysfunction

    • Acute respiratory distress syndrome

  • Engineered CLIC2 Variants: Structure-function studies could lead to enhanced variants:

    • Increased stability

    • Enhanced MMP14 binding affinity

    • Tissue-specific targeting

    • Fusion proteins with complementary activities

  • Biomarker Development: The correlation between CLIC2 expression and cancer prognosis suggests potential as a biomarker:

    • Tissue expression levels for cancer prognostication

    • Circulating CLIC2 as a liquid biopsy component

    • CLIC2/MMP ratio as an indicator of metastatic potential

  • Peptide Therapeutics: Identification of the active domains of CLIC2 responsible for MMP14 inhibition could lead to development of peptide therapeutics with improved pharmacokinetic properties compared to the full protein.

What methodological advances could accelerate CLIC2 research?

Several methodological advances could significantly accelerate CLIC2 research:

  • CRISPR/Cas9 Gene Editing in Rat Models: Development of rat CLIC2 knockout and knock-in models would provide valuable tools for in vivo functional studies, overcoming the limitation of CLIC2 absence in mice .

  • Structural Biology Approaches: Advanced structural determination of CLIC2 in complex with binding partners like MMP14 could provide crucial insights:

    • Cryo-EM structures of CLIC2-MMP14 complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • In silico molecular dynamics simulations to predict conformational changes

  • Single-Cell Analysis: Application of single-cell transcriptomics and proteomics to study cell-specific CLIC2 expression and function could reveal heterogeneity in expression and activity across cell populations.

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize CLIC2 localization at tight junctions

    • Live-cell imaging with tagged CLIC2 to monitor trafficking and secretion

    • Intravital microscopy to observe CLIC2 function in vivo

  • High-Throughput Screening Platforms:

    • Development of assays to screen for small molecule modulators of CLIC2 activity

    • Peptide library screening to identify sequences that mimic CLIC2's MMP14 inhibitory effect

    • siRNA/CRISPR screens to identify regulators of CLIC2 expression and function

  • Organoid and Microfluidic Systems:

    • Vascularized organoids to study CLIC2's role in 3D tissue architecture

    • Tumor-on-chip models to investigate CLIC2's effect on cancer cell invasion

    • Blood-brain barrier models to study CLIC2's role in barrier function

These methodological advances would address current limitations in CLIC2 research and facilitate more comprehensive understanding of its functions in physiological and pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.